KEGG   Staphylococcus pseudintermedius ED99: SPSE_0217Help
Entry
SPSE_0217         CDS       T02008                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPSE_0217 (galU)
   00052 Galactose metabolism
    SPSE_0217 (galU)
   00500 Starch and sucrose metabolism
    SPSE_0217 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SPSE_0217 (galU)
Enzymes [BR:sdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPSE_0217 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
251652..252515
Genome map
AA seq 287 aa AA seqDB search
MKKITKAVIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAVRAGIEDIIIVTGKH
KRAIEDHFDNQIELEMNLAEKGKDDLLEKVQHATQLANMFYVRQKEQKGLGHAIWTAKQF
IGDEPFAVLLGDDIVESETPAIQQLMEEYERTGKSVIGVQEVPERETHRYGIVDPKNQQE
RLYEVTQFVEKPVFGTAPSNLAIMGRYVLTPDIFDYLENQEEGAGGEIQLTDAIERLNQS
QQVFAYRFEGERFDVGEKVGFVKTTIQFALRDAEMADEIRAFLKEVQ
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataacgaaagctgtgattcccgcagcaggtttaggtacacgttttttacct
gcgacgaaagctatgccgaaagagatgttgccgattttagataagccgacgattcaatat
attgtggaagaagcggtacgtgcgggcattgaagatattattatcgttactggtaaacat
aaacgtgcgattgaagatcattttgacaatcaaatcgagctcgaaatgaacttggctgaa
aaaggcaaggatgatttgttagaaaaggttcaacatgcgacacaattggcgaatatgttt
tacgtccgtcaaaaagagcaaaaagggttagggcatgcgatttggacggcgaaacaattt
attggtgacgagcctttcgcggtattgctaggtgatgatattgtcgaatcagagacgcca
gcgattcaacagctgatggaagaatatgagcgcacaggtaaatccgtcatcggtgtgcaa
gaagtgcctgaacgtgaaacgcatcgttacgggattgttgacccgaaaaatcaacaagaa
cgtttgtatgaagtgacgcaatttgttgaaaagccagtctttggtacagcaccatctaat
ttggcgattatgggtcgctatgtattgacaccggatattttcgattatttggaaaatcaa
gaagagggagctggcggtgaaattcaattaaccgatgcgattgagcgtttaaatcagtcg
caacaagtatttgcctaccgtttcgaaggtgagcgatttgatgtgggtgaaaaagtcggt
ttcgtcaaaacaacgattcaatttgctttacgtgatgcagaaatggctgacgaaattcgt
gcatttttaaaagaagtacaatga

DBGET integrated database retrieval system