KEGG   Staphylococcus pseudintermedius ED99: SPSE_0339Help
Entry
SPSE_0339         CDS       T02008                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPSE_0339 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPSE_0339 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPSE_0339 (trpB)
Enzymes [BR:sdt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPSE_0339 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
400354..401559
Genome map
AA seq 401 aa AA seqDB search
MKNIQLEADEHGFFGEYGGKYVPETLMPAIEELKKAYDVAKQDPEFQRDYHHYLKHYVGR
ETPLTYADSYTKALGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKLVAETGAGQ
HGVASATIAALFGMELVVFMGEEDIRRQQLNVFRMELLGAEVVPVTDGQGTLSDAVNKAL
QYWVAHVDDTHYLLGSALGPDPFPTMVRDFQRVIGDEIKAQLQEKEGRLPNAVVACVGGG
SNAIGTFYPFIEDASVKLYGVEAAGEGIDSERHALAINKGKKGVLHGTKMYLIQDDNHQI
KLAHSISAGLDYPGVGPEHSYYHDIGRVDYVTADDKEAMEALVRFTKAEGIIPAIESAHA
LSYVEKLAPQLDKDDILVVTVSGRGDKDMETIKHYMEEKEA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattcaattagaagcagatgaacatggatttttcggagagtacgggggcaaa
tacgtacccgaaacgctcatgccagctatcgaagaattgaaaaaggcttatgatgtggcg
aaacaagatcctgaatttcaacgtgactatcatcattatttaaaacattacgttggacgc
gaaacgccgcttacgtatgccgattcttacacgaaagcattaggtggcgcgaaaatttat
ttgaaacgtgaagatttgaatcatacgggggcacataaaattaataacgcgattggtcaa
gctttactcgcgaaacgcatgggtaagaagaagcttgtcgctgaaactggcgcaggtcaa
catggtgtcgcaagtgcaacaattgcagcgttattcggtatggaactcgttgtatttatg
ggggaagaagatatccgtcgtcaacaactcaatgtctttcggatggagttactcggggcg
gaagtcgtacctgtgactgacggacaagggacgttatcagatgcggtgaataaagcactt
caatattgggtcgcacatgtcgatgatacacattacttacttggttcagcgctcggaccg
gacccatttccgacgatggtgcgcgattttcaacgtgtcattggtgatgaaatcaaagca
caacttcaagaaaaagaagggcgtttaccgaatgccgtcgtcgcgtgtgtcggtggtggt
tccaatgcaatcggtacgttctatccatttattgaagatgcatcagtgaagttgtatggc
gtggaagcagcaggggaaggtatcgattcagaacgacatgctttagcaattaataaagga
aaaaaaggtgtactccatggaacgaaaatgtatttaattcaagatgacaaccatcaaatt
aaattggcacattctatttcagcaggcctcgattatccgggtgtgggccctgagcatagt
tattaccatgacatagggcgcgtcgattatgtcactgctgacgataaagaagcgatggaa
gcactcgtacgtttcacaaaagcagaagggattattccagcaattgaaagtgctcatgct
ttaagttatgttgaaaagctcgcaccacaattggataaagatgacattctcgtcgtaaca
gtgtcaggtcgtggtgataaagatatggaaacgattaaacattatatggaagaaaaggag
gcgtaa

DBGET integrated database retrieval system