KEGG   Staphylococcus pseudintermedius ED99: SPSE_0340Help
Entry
SPSE_0340         CDS       T02008                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPSE_0340 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPSE_0340 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPSE_0340 (trpA)
Enzymes [BR:sdt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPSE_0340 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
401562..402311
Genome map
AA seq 249 aa AA seqDB search
MHAKQFVAYIMGGPEFIAQLKALDEVGADYVEIGIPFSDPVADGPIIMEAGQAAIRAGMT
AQKIFDQLKTVNGQLNTRYLLMTYYHTIETYGEAAFMAEAEAAGVEGLIIPDMPFEYIEQ
LKARYPERQLKFISLIAMTAVPERRQRIAQSAEGFIYTITMNQITGQNGNFHPELKQNIL
DIKQHSDVPVMAGFGIRTPEHVQEIIEVADGVIIGSEIVRRFNEEGIEVTKQYLARVREA
LGKHRSTAQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcgaaacaatttgtagcgtacattatgggtggtccagagtttatagcacaattg
aaagcattagatgaagttggcgcggattatgttgaaattggtatcccattttctgatcct
gtcgcggatggtcccatcattatggaagcaggacaggcggcgattcgagcagggatgacg
gcccagaaaatttttgatcagctgaaaacagtgaacggtcagctcaacacacgttattta
ctgatgacgtattatcatacgattgaaacttatggagaagcggcatttatggctgaagca
gaagcggccggtgtagaagggctcatcattccggatatgccgtttgaatatatcgaacaa
ttgaaagcccgttatccagagcgacagttgaaattcatctcactaatcgcgatgactgct
gtacctgaacgacgtcaacgcatcgctcaatccgctgaaggatttatttatacgatcaca
atgaatcaaattacaggtcaaaacggcaatttccaccctgaattgaagcaaaatatttta
gatattaaacaacatagtgatgtgccggtgatggccggatttggtattcgtacacctgaa
catgttcaagaaatcatcgaagtggctgatggtgtcattatcggaagtgaaatcgttcgc
cgttttaatgaagaaggcattgaagtaacgaaacaatatttagcgagggttcgtgaagca
cttggtaagcatcgttcaactgcacagtaa

DBGET integrated database retrieval system