KEGG   Staphylococcus pseudintermedius ED99: SPSE_0353Help
Entry
SPSE_0353         CDS       T02008                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00010  Glycolysis / Gluconeogenesis
sdt00030  Pentose phosphate pathway
sdt00051  Fructose and mannose metabolism
sdt00680  Methane metabolism
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
sdt01200  Carbon metabolism
Module
sdt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSE_0353 (fbp)
   00030 Pentose phosphate pathway
    SPSE_0353 (fbp)
   00051 Fructose and mannose metabolism
    SPSE_0353 (fbp)
  Energy metabolism
   00680 Methane metabolism
    SPSE_0353 (fbp)
Enzymes [BR:sdt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SPSE_0353 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 DUF87
Motif
Other DBs
NCBI-ProteinID: ADX75695
Position
complement(417544..419499)
Genome map
AA seq 651 aa AA seqDB search
MSSQTEKELKRQYLDLIAEKFDSEEKVATEIIHLESILDLPKGTEHFVSDLHGEYHAFQH
VLRNGSGNLQQKIHDIFKSRLDPQEMNELIALVYYPEEKIKRIKNGFNTKSERHTWYEKT
INRLLELVKYTSSKYTRSKLRKSLAPEYTFIIEELLYKSNQFNNKKDYYDAILRQIIQLN
QADKLIISLANTTQRLVVDHLHVVGDIYDRGPHPDKIMDTLIDYHSVDIQWGNHDVLWMG
AYSGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDDNEAFRPKKHPEKNP
SESEILQITKIHQAIAMIQFKLEGPIIKRRPEFEMNERLLLDRVDYRNRTIELNGKVHPI
ENTCFRTVDRRQPTALLEEEQEVMDKLLTSVQESEKLRRHVDFLMKKGNLYLRYNGNLLI
HGCIPIDEQGEMEGMTIDGRFLTGRALIDEFEKHVRYAYEHKEVEDDLSTDLVWYLWTGK
YSSLFGKRAMTTFERYFIKDKNTHKEVKNPYYRLRENEDVVKKMLEEFDMNPEQGRIING
HTPVKERDGENPIKANGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQHFNSKE
KLLETGEDELSIRRVVDKELERKLIRDTNEGAELQKEIDMLKALMSYRYMK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcaaacagaaaaagagttaaaaaggcagtatttagatttaatcgctgaaaaa
ttcgattcagaagaaaaagttgcgactgaaattatccatttagagtcgattttggattta
cctaaaggtacagaacactttgtgagtgacttacacggtgaatatcacgcatttcaacat
gtgttgcgtaatggatctggtaatttacaacaaaagattcatgacattttcaaatcacga
ttagacccccaagaaatgaatgaattgattgcattagtctactatccagaagaaaaaatt
aagcgtattaaaaatggttttaatacaaaaagtgaacgtcacacatggtatgaaaaaacg
attaatcgcttactagaattagtaaaatatacctcttccaaatatacacgttcaaaatta
cgtaaatcgttagcgccagaatatacatttatcattgaagagttactctataaaagtaac
caattcaacaacaaaaaagattattatgatgcaattctgagacaaattatccaattgaac
caagcggataaacttattatcagtcttgcaaatacgacacaaagattagttgtagatcat
ctccacgtcgttggtgatatttacgaccgtggtcctcacccagacaaaattatggataca
ctcattgattaccattctgtcgatattcaatgggggaaccatgatgttttatggatgggt
gcctactctggttcaaaggtgtgcctcgcgaacttactccgcatttgtgcacgttacgac
aatctcgacattattgaagatgcttacggtattaacttgcgtccattattaacgctagcc
gaaaagtattacgatgataatgaggcatttcgtccgaaaaaacatcctgagaaaaatcca
tcagagtcagaaattttacagattacaaaaattcatcaagccattgcaatgattcaattt
aaattggaaggaccgattattaaacgtcgtcctgaatttgaaatgaatgaacgtttactg
ctcgatcgtgtggattatcgcaaccgtacaatcgaactgaacggcaaagtccatccgatt
gaaaatacatgttttagaacagtagaccgtcgccaacctactgcattgcttgaagaagag
caagaagtgatggataagttgctcacatctgtacaagaatctgagaaattgcgtcgtcat
gtagacttcttaatgaaaaaagggaacttgtacttacgttacaatggtaatttactcatt
cacggttgtattcccattgacgagcaaggtgaaatggaaggtatgacaattgatggccgt
ttcttgactggacgtgcactgattgatgaatttgaaaagcacgtccgttacgcttatgaa
cataaagaagtagaagatgacctttcaacggatttagtctggtatttatggactggtaaa
tattcatcattattcggtaaacgtgcgatgacgacattcgagcgttactttattaaagac
aagaacacgcataaagaagtgaaaaacccatactatcgtttgcgtgaaaatgaagacgtt
gtgaaaaagatgttggaagaattcgacatgaatcccgaacaaggtcgtattattaacgga
catacacctgtgaaagagcgcgatggtgaaaatcctattaaagcaaacggtaaaatgctt
gttattgacggtggtttctctaaagcgtatcaatcgacgacaggtatcgcgggctacacg
ttgctgtataactcgtttggtatgcagcttgtggcgcaccaacattttaattcaaaagag
aagttattagagacgggtgaagatgagttgtctattcgtcgtgttgtggataaagagttg
gagcgtaagttgattcgagatacgaatgagggggccgagttgcagaaggagattgatatg
ttgaaagcgttgatgtcgtatcgttatatgaaatga

DBGET integrated database retrieval system