KEGG   Staphylococcus pseudintermedius ED99: SPSE_0480Help
Entry
SPSE_0480         CDS       T02008                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sdt00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sdt00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
556149..557174
Genome map
AA seq 341 aa AA seqDB search
MNINIEQQSNGIELIKIENKESKIVFMNYGARIVSWKIGDNNIVLGNEVEADEFYPHNPF
YFGATVGRFGGRIAKGQFELNGQTYQLEQNDGDNHLHGGLQGLSNRLFDYEIIESETEES
AQVYFTTTVKQDEDHYPGNIDIKVVFTYDASKTWTVEYFAESDADTLFNPMNHVYFNLNR
DNKVVDNHVIASEKLQMFPLDASGMPVLEPVDLAAIMGSHEIELATLFNTGDVHIQQQVT
TRGGLDHPFEVKDGKMTISNRDLVLHVETDAPQIVMYTLNDSEDWKSRMNIFKPHSGITI
ETQSIPNDINLLGTSAHSVLKAHTPFYSKTSYHVELKPRNA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaacattgaacaacaatctaacggaattgaactcattaagattgaaaataag
gaaagtaaaattgttttcatgaattatggtgcgcgcattgtcagttggaaaattggagat
aataacattgtactggggaatgaagtggaagcggatgaattttatcctcacaatccattt
tatttcggtgcaacggttggacgttttgggggacgtattgcgaaaggtcaatttgaatta
aatggacaaacatatcaattagaacaaaatgatggtgacaatcatttacatggcggacta
caaggattatctaaccgcttatttgattatgaaatcattgaaagcgaaactgaagaaagc
gcgcaagtttattttacgactacagtgaagcaggatgaagatcattacccgggaaatata
gacattaaagtcgtgtttacgtatgatgcttcgaaaacgtggacagttgaatattttgcg
gagtctgatgcggatacattgttcaacccgatgaaccacgtttactttaatttgaatcgt
gacaacaaagttgtggataatcacgtcattgcaagtgaaaaactacagatgtttcctttg
gacgcgtcgggtatgccagtgttagagccggttgatttagcagcaataatgggcagtcat
gaaattgaacttgcgacattattcaataccggagatgtccatattcaacaacaagtcaca
acgcgtggtggtctcgatcatccttttgaagtgaaggatggcaagatgacgatttcaaac
cgtgacttagtattacatgttgagacagatgcaccacaaattgtgatgtacacgttaaat
gattctgaagattggaaaagccgtatgaatatttttaaaccacattcagggattacgata
gaaacacaaagcataccgaacgatattaatcttttaggtacatcagcacattcagtgtta
aaagcgcatacacctttttactctaaaacaagttatcatgtggaattaaagccaagaaac
gcatag

DBGET integrated database retrieval system