KEGG   Staphylococcus pseudintermedius ED99: SPSE_1060Help
Entry
SPSE_1060         CDS       T02008                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00010  Glycolysis / Gluconeogenesis
sdt00620  Pyruvate metabolism
sdt00640  Propanoate metabolism
sdt00680  Methane metabolism
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
sdt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSE_1060 (acsA)
   00620 Pyruvate metabolism
    SPSE_1060 (acsA)
   00640 Propanoate metabolism
    SPSE_1060 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SPSE_1060 (acsA)
Enzymes [BR:sdt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SPSE_1060 (acsA)
Lipid biosynthesis proteins [BR:sdt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SPSE_1060 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADX76333
Position
1084583..1086292
Genome map
AA seq 569 aa AA seqDB search
MKVEVYKGEQGNFNLTNYQATYDQFDWKEVEKVFSWNETGKINMAYECIDRHVNEGKADK
IALNYKDNRRKESYTFKDLQEKSNQAANVLKNKANVQKGDRVFIFMPRTPELYFAFFGIL
KLGGIVGPLFEAFMEKAVKDRLENSDAKVIITTNSLLSRIPQEQLPNLETIVIVDDEVDV
KYVDFNKALATASTAFNIEWLDREDGLILHYTSGSTGQPKGVLHVQEAMLLHYISGKYVL
DFQEDDVYWCTADPGWVTGTSYGIFSPWLHGVTNCIAGGRFSPENWYAMIEDFKVTIWYT
APTALRMLMSAGDDLVEKYDLSSVRSILSVGEPLNPEVIKWAKKVYGKRVLDTWWMTETG
GHMIVNYLAEDIKLGSMGKPLPGIEAAIIDNEGNVLPPNRMGNLAVKKGWPSMMRQVWKN
PEKYQSYFIGDWYVSGDSAYQDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGVIGKPDPVRGEIIKAFVALRQGYEPSDDLKEDIRKFVKEGLAAHAAPREIEFKDKLP
KTRSGKIMRRVLKAWELDLPTGDLSTMED
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgaagtttacaaaggggagcaaggcaacttcaatttaactaattatcaagca
acatatgatcagtttgattggaaagaggtagagaaagtattttcttggaacgaaactgga
aaaatcaacatggcatatgaatgtatcgatcgtcatgtcaatgaaggaaaagcagataaa
attgctttaaattataaagataatcgacgaaaagaaagctatacatttaaagatttacaa
gaaaaatcgaaccaagctgccaatgtgttgaaaaataaggcgaatgtacaaaaaggggat
cgtgtcttcatttttatgcctcgtacaccagaactttattttgcattttttggcatctta
aaattgggcggtattgtaggtcctttatttgaagcatttatggaaaaggcagtgaaagac
cgtttggaaaatagtgatgcgaaagtcattattacgacaaatagtttattatcgcgtatt
ccccaagagcaactgccaaatttagaaacgattgttattgtcgatgatgaagttgatgtg
aaatatgtagactttaataaagcattggcaaccgcatcgacagcgtttaatatagaatgg
ttagaccgtgaagatggcttgattttacattatacatctggttcaacaggtcagccaaaa
ggggtattgcatgttcaagaagcaatgttgttgcattacatttcgggtaaatacgtactc
gattttcaagaagatgacgtgtattggtgtactgctgacccaggttgggtgacaggcaca
tcttatggcattttctcaccatggctgcacggtgtaacgaactgtatcgctggaggtcgt
ttttcaccagagaattggtacgcaatgattgaagactttaaagtcacgatttggtatact
gcaccgacagcgttacgtatgctcatgagtgcaggtgatgacttagtcgaaaagtatgat
ttatcgtctgtacgtagcattttatctgttggggagcccctcaatccagaagtcatcaaa
tgggcgaaaaaggtctatggtaaacgtgtactagatacgtggtggatgactgaaactggg
ggacatatgattgtgaattacttggcagaagatattaagctcggttcaatgggtaaaccg
ctgcctggtattgaagcggcaattatcgataatgaaggtaacgttttaccaccgaatcgc
atgggtaacttagcggttaaaaaaggttggccttctatgatgcgtcaagtttggaaaaat
cctgaaaagtatcaatcatactttattggtgattggtatgtatctggtgactctgcttac
caagatgaagatggttatttctggttccaaggtcgagtcgatgatgtgattatgactgct
ggtgaacgtgtcggtccatttgaagtggaatctaaattagtggaacatgaagcagtggca
gaagcgggtgtcattggtaaacctgatccagtgcgtggtgaaatcattaaagcattcgtc
gcattacgtcaagggtatgaaccttctgatgacttaaaagaagatattcgtaaatttgtt
aaagaagggttagctgctcatgctgcaccgagagaaattgaatttaaagataaattaccg
aaaacacgttcaggtaaaattatgcgccgtgtgttaaaggcatgggagctcgatttaccg
actggtgatttaagtacaatggaagattaa

DBGET integrated database retrieval system