KEGG   Staphylococcus pseudintermedius ED99: SPSE_1103Help
Entry
SPSE_1103         CDS       T02008                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPSE_1103 (pfkA)
   01230 Biosynthesis of amino acids
    SPSE_1103 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSE_1103 (pfkA)
   00030 Pentose phosphate pathway
    SPSE_1103 (pfkA)
   00051 Fructose and mannose metabolism
    SPSE_1103 (pfkA)
   00052 Galactose metabolism
    SPSE_1103 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SPSE_1103 (pfkA)
Enzymes [BR:sdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPSE_1103 (pfkA)
Protein phosphatases and associated proteins [BR:sdt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPSE_1103 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1133447..1134415
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAIRAVVRKALYHNIEVYGVYQGYQGLINDDIRKLELGSVGDI
IQRGGTFLYSARCPEFKEKEVRQKGIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIESVDKIRDTASSHARTFIIEVMGRDCGDLAL
WSGLAVGAETIILPETETDIKDIAEKIQHGIDRGKKHSIIIVAEGCMTGDMCASELTKYI
NVDARVSVLGHIQRGGSPTGADRVLASRLGGYAVELLLNGETAKGVGIKDNRLVATNFDE
IFNTSERQINQRMLGLTEELSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcagttttaacaagtggcggagattctccggggatgaatgcagcaatt
cgagcagttgtaagaaaagcgctttatcacaatattgaagtctatggtgtgtatcaaggt
tatcaaggtttaatcaatgacgacattcgcaaactcgagttgggttcagttggcgatatt
attcaacgtgggggtactttcttatattcagcacgttgcccagaatttaaagaaaaagaa
gtacgccaaaaagggattgaaaaccttagaaagcgtgggattgaaggtttagtcgttatt
ggtggcgatggaagttaccgtggtgcacaacgtattagtgaagagtgtaaagaaattcaa
acgattggtattccaggtacaattgataacgatattaatggtactgattttacaatcggt
tttgatacagcgttaaatacaattattgaatctgtggacaaaatccgagatactgcttca
agccacgcacgcacttttatcattgaagttatgggccgtgactgtggagatttagcatta
tggtcaggtttagctgtaggcgctgaaacaatcattttacccgaaacagagacagacatt
aaagatatcgcagaaaaaattcaacatggtattgatagaggtaaaaagcattctattatc
attgttgcagaaggttgtatgacgggtgatatgtgcgcatcagaattaacaaaatatatt
aatgttgatgcacgtgtatctgtgctcggccatattcaacgtggcggtagcccaacaggt
gcagaccgagtacttgcatcacgtttagggggctatgctgttgagcttttacttaacggc
gaaacggcgaaaggtgtcggcattaaagacaaccgattagttgcgactaattttgatgaa
atttttaacacttcagaacgtcaaattaaccaacgtatgttaggtttaactgaagaatta
tctatataa

DBGET integrated database retrieval system