KEGG   Staphylococcus pseudintermedius ED99: SPSE_1103Help
Entry
SPSE_1103         CDS       T02008                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00010  Glycolysis / Gluconeogenesis
sdt00030  Pentose phosphate pathway
sdt00051  Fructose and mannose metabolism
sdt00052  Galactose metabolism
sdt00680  Methane metabolism
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
sdt01200  Carbon metabolism
sdt01230  Biosynthesis of amino acids
sdt03018  RNA degradation
Module
sdt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sdt_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSE_1103 (pfkA)
   00030 Pentose phosphate pathway
    SPSE_1103 (pfkA)
   00051 Fructose and mannose metabolism
    SPSE_1103 (pfkA)
   00052 Galactose metabolism
    SPSE_1103 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SPSE_1103 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SPSE_1103 (pfkA)
Enzymes [BR:sdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPSE_1103 (pfkA)
Protein phosphatases and associated proteins [BR:sdt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPSE_1103 (pfkA)
Messenger RNA biogenesis [BR:sdt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SPSE_1103 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADX76376
Position
1133447..1134415
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAIRAVVRKALYHNIEVYGVYQGYQGLINDDIRKLELGSVGDI
IQRGGTFLYSARCPEFKEKEVRQKGIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIESVDKIRDTASSHARTFIIEVMGRDCGDLAL
WSGLAVGAETIILPETETDIKDIAEKIQHGIDRGKKHSIIIVAEGCMTGDMCASELTKYI
NVDARVSVLGHIQRGGSPTGADRVLASRLGGYAVELLLNGETAKGVGIKDNRLVATNFDE
IFNTSERQINQRMLGLTEELSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcagttttaacaagtggcggagattctccggggatgaatgcagcaatt
cgagcagttgtaagaaaagcgctttatcacaatattgaagtctatggtgtgtatcaaggt
tatcaaggtttaatcaatgacgacattcgcaaactcgagttgggttcagttggcgatatt
attcaacgtgggggtactttcttatattcagcacgttgcccagaatttaaagaaaaagaa
gtacgccaaaaagggattgaaaaccttagaaagcgtgggattgaaggtttagtcgttatt
ggtggcgatggaagttaccgtggtgcacaacgtattagtgaagagtgtaaagaaattcaa
acgattggtattccaggtacaattgataacgatattaatggtactgattttacaatcggt
tttgatacagcgttaaatacaattattgaatctgtggacaaaatccgagatactgcttca
agccacgcacgcacttttatcattgaagttatgggccgtgactgtggagatttagcatta
tggtcaggtttagctgtaggcgctgaaacaatcattttacccgaaacagagacagacatt
aaagatatcgcagaaaaaattcaacatggtattgatagaggtaaaaagcattctattatc
attgttgcagaaggttgtatgacgggtgatatgtgcgcatcagaattaacaaaatatatt
aatgttgatgcacgtgtatctgtgctcggccatattcaacgtggcggtagcccaacaggt
gcagaccgagtacttgcatcacgtttagggggctatgctgttgagcttttacttaacggc
gaaacggcgaaaggtgtcggcattaaagacaaccgattagttgcgactaattttgatgaa
atttttaacacttcagaacgtcaaattaaccaacgtatgttaggtttaactgaagaatta
tctatataa

DBGET integrated database retrieval system