KEGG   Staphylococcus pseudintermedius ED99: SPSE_1133Help
Entry
SPSE_1133         CDS       T02008                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPSE_1133 (hemD)
Enzymes [BR:sdt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SPSE_1133 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1166883..1167560
Genome map
AA seq 225 aa AA seqDB search
MKPIIVMTQTKRYDDQRAEIVHLPFVTTEPLPFDQSVLGRHYDWLVFTSQNAVTHFQPYL
KLLNFNKLAVIGEKTKAFCESQGLRVDFFPADYSQEGFLDAFPTQQGQHILIPSSQRARP
LLQEVLQVRGFNVEKIDLYTSCFLLENVKEAKARIETGQVDALTFASASAVKAFFHDDTS
LNFDSYYAIGQQTARQIQDYGYSCSIADIQTLESMVTKILEERVQ
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctattatagtgatgacccaaaccaagcgttatgatgatcagcgcgctgaaatc
gttcatcttccatttgtgacgactgaaccacttccttttgatcaatcagtgctaggtcgt
cactatgattggcttgtttttacatctcaaaatgccgttacgcattttcaaccttattta
aagttgttaaattttaataaattagcggtcattggcgagaaaacgaaagcattttgtgaa
tcacaaggattgcgagtggatttcttcccagcagattactcacaagaaggatttctcgat
gcattccccacacaacaagggcagcatattttgattccatccagtcaacgcgcacggcca
ttactgcaagaagtgttgcaagtacgtggtttcaatgttgaaaaaattgatttgtatact
tcatgttttttattggaaaatgtgaaagaagccaaagcacgtatcgaaacaggtcaagtg
gatgcattgacgtttgcgagtgcttctgctgtcaaggcgttttttcacgatgatacgtct
ttaaatttcgactcgtattatgcaattggtcaacaaacagcacgacagattcaagattac
ggctattcatgttctattgctgacattcaaactttagaatcaatggtgacaaaaatttta
gaagagagggttcaataa

DBGET integrated database retrieval system