KEGG   Staphylococcus pseudintermedius ED99: SPSE_1173Help
Entry
SPSE_1173         CDS       T02008                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPSE_1173
Enzymes [BR:sdt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SPSE_1173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1207529..1209928
Genome map
AA seq 799 aa AA seqDB search
MENPTLFDHTFIKGTVEMILFQNTDNHYTVLKVEIEETNGDFDDMATVVGYFPNMVEDES
YTFKGQIVQHARYGQQLKAETFQKEIPHTKDAVIAYLSSELFKGIGKKTAESIVNTLGEN
AIHDILKDESVIEQVPKLSKAKQQQIVEQIYANQESEQVMIRLNELGFGSKLAMDIYKFY
KSDTLTVLDQNPYQLVYDIKGVGFNKADQLAQQLGIHPEHPDRLKAGLLYLVEDTCIKQG
HTYLPQEALINETIQLLSQGKDSSVDYDTMTQILAELVEEKRLVNQEEMVAIPSLYYSEI
KSTQNLYKIFANREHLTTFDASDIQLHIGEIEEVNEVHYAPSQKEALEYAIQHKVMLLTG
GPGTGKTTVIKGIVQLYAEIHGISLDYDDYSDEDDYPVVLAAPTGRASKRLHEATGLEAM
TIHRLIGWNQDTKPQDKLDNEIHAKLIIIDEMSMVDTWLFHQFMDAVPIDAQVVLVGDED
QLPSVGPGQVFKDLIDANVLPRINLTEVYRQQDGSSIIDLAHRMKLGEKVDITQRFHDRS
FIPCQTDQIPQVVEKVVNNAVQKGYTMADIQVLAPMYRGNAGIKKLNQILQGILNPLSDE
SQREIEFGDVLFRKGDKVLQLINRPNDNVFNGDIGVIVGIFWAKENALNKDVVVVDYDGN
EITYLRSDLTELTHAYCTSIHKAQGSEFPIVIMPIVKQYFRMLQKPILYTGLTRAKQSLV
FLGDADAFNIGLATAGQTRLTQLQTFLMQYFTPEDTDDKTDTDTASAEFILTEATMFKIH
PMINMGEVTPYDFLEIDKV
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatccaacactgtttgaccatacatttattaaaggcaccgtagagatgattttg
tttcagaatacggacaatcattacacagtgcttaaagttgaaatagaagaaacaaatggt
gactttgatgatatggcaacagtggttggatattttccgaatatggtagaagatgagtcg
tacacttttaaaggccaaatcgtgcaacatgcaagatatggtcagcaattaaaagctgag
acgtttcaaaaagaaattcctcataccaaagatgctgttattgcatatttatctagtgaa
ttgtttaaagggattggtaaaaaaacagcagaatccattgtcaatacattaggtgaaaat
gcgattcatgacattttgaaagatgaatctgtcatcgaacaagtgcctaaactgtctaaa
gcgaaacaacaacaaattgtcgagcagatttatgccaaccaagaaagtgaacaagtgatg
attcgattgaacgaacttggttttggttcaaagcttgcgatggacatttacaagttttat
aaaagtgatacattaacggtactcgaccaaaatccgtatcaacttgtttatgacattaaa
ggggttggttttaacaaagcggaccaactggcacaacagctcggtattcatccagagcac
cccgaccgtttaaaagccggcttactttatttagttgaagatacgtgtattaaacaaggt
catacgtacctcccacaagaagcgttaatcaatgaaacgattcaactgctgtctcagggc
aaagattcaagtgtcgactatgacaccatgacgcaaattttagctgaattagttgaagaa
aaacgactagtgaatcaagaggaaatggtggccatcccaagtctttattattcggaaatt
aaaagcacacaaaatttatataaaatatttgccaatcgagagcatttaactacatttgat
gcttcagatattcaattacatattggggaaattgaagaggtcaatgaagtacattatgcc
ccttctcaaaaagaggctttagaatatgcgattcaacataaagtcatgcttctcacgggt
ggaccaggtacagggaaaacaactgtcattaaaggaattgtccagttatatgcagaaatt
cacggcatctcattagattacgatgactattcagatgaagatgattatccggtcgtatta
gctgcaccaaccggaagagcgtctaaacgtttacatgaagcgacagggttagaagcaatg
acgattcaccgcttaattggttggaatcaagatacgaagccgcaagacaaattagacaat
gaaattcatgcgaaattgattattattgatgaaatgtctatggtcgacacttggctattc
catcaatttatggatgcagtccctatagatgcccaagtcgtattagtcggtgatgaagac
cagcttccatcagttggccctggacaagtttttaaagatctcattgatgcaaatgtatta
ccgcgcatcaatttaactgaagtttatcgccaacaggacggctccagtattattgattta
gcgcatcgtatgaaactcggtgaaaaagttgatattacccaacgttttcacgatcgttcg
tttattccatgtcaaaccgatcaaattccacaagtcgtagaaaaagtcgtcaacaatgcc
gtgcaaaaagggtatacaatggcagatattcaagtgctcgcgccgatgtatcgtggtaat
gcagggattaaaaagctcaatcaaattttacaaggcattttgaaccctttgtcagacgaa
tcgcaacgtgagattgaatttggtgatgttctatttcgtaaaggcgacaaagtattgcaa
ctgattaatcgtccaaatgataatgtgtttaatggtgatattggtgttattgtcggtatt
ttttgggcaaaggaaaatgctttaaataaagatgtcgtggtcgttgattatgatgggaac
gaaattacttatttacgctctgatttgacggaattgacacatgcatattgtacttcgatt
cataaagcgcaaggttcagagtttccaattgtcatcatgccgattgttaagcagtatttt
agaatgttacaaaaaccgattttatatactggattaacgcgtgccaaacaatcgctcgtt
tttcttggtgatgcagatgcttttaatatcgggttagcgactgcgggtcaaacgcgatta
acacaattacaaacgttcttaatgcaatattttactccggaagatactgatgataaaaca
gatactgatacagcttcggctgagtttattttaactgaagcgactatgtttaaaatccat
ccgatgattaatatgggtgaagtgacaccttatgactttttagaaattgacaaagtttaa

DBGET integrated database retrieval system