KEGG   Staphylococcus pseudintermedius ED99: SPSE_1250Help
Entry
SPSE_1250         CDS       T02008                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPSE_1250 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSE_1250 (glk)
   00052 Galactose metabolism
    SPSE_1250 (glk)
   00500 Starch and sucrose metabolism
    SPSE_1250 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SPSE_1250 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPSE_1250 (glk)
   00524 Butirosin and neomycin biosynthesis
    SPSE_1250 (glk)
Enzymes [BR:sdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPSE_1250 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1280993..1281979
Genome map
AA seq 328 aa AA seqDB search
MNKQLILAADIGGTTCKLGIFDKSLTQLSKWSIETDISDPTGEVLLKQIYDAFVHEMERN
HYDMNEVVGMGIGVPGPVKFESGVVNGAVNLNWPQPVNVSEIMQQFVSFPVYVDNDANVA
ALGEKHNGAGKDADDVVAITLGTGLGGGIIANGEIVHGHNGSGAELGHFRVDHDQRFKCN
CGKSGCIETVASATGVMNLVYFYYPKLTFKSSILPLIKEHKVTAKAVFDAAKAGDQFCIF
ITERVAQYVAYLASIISVTTNPKYIILGGGMSDAGDILIENIKTEYYHLAFTPSQQGTEI
VRAELGNDAGIVGAAGLIKTYIIEKERI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacaattaattttagctgcagatattggtggcacgacatgtaaattaggtatt
tttgataaatctttaacacaattatctaaatggtctatagagacggatatctcagatcca
acaggtgaagtattacttaaacaaatttatgatgcgtttgtgcatgaaatggaacgcaac
cactatgatatgaatgaagtagtgggtatgggtattggtgtaccaggccctgttaaattt
gaatctggtgttgtaaatggtgctgttaacttgaattggccacaacccgttaacgtctca
gaaataatgcaacaatttgtgtcattcccggtgtatgttgataatgatgcaaatgtggcc
gctcttggtgaaaaacataatggtgccggtaaagatgcggatgatgtcgttgcaattacg
ctagggactggtttaggtggcggtattatcgctaatggtgaaattgttcacggtcataac
ggctcaggtgctgaacttggacatttccgtgtcgaccacgatcaacgtttcaaatgtaat
tgtggtaaatcaggctgtattgaaacagtagcttctgcgacaggtgtcatgaatttagtt
tatttctactatccgaagctcactttcaagtcttcaattttaccgctcattaaagaacac
aaggtcacagctaaagcagtattcgatgcagctaaagcaggtgaccaattctgcattttc
attacagaacgtgtcgcacaatacgtcgcatatcttgcaagcattatcagtgtcacaact
aaccctaaatacattattttaggtggcggtatgtccgatgcaggcgatattttaattgag
aatatcaaaacagaatattaccatcttgcattcacgccttcacaacaaggcactgaaatt
gtacgtgctgagttaggtaatgacgcaggtattgtgggggctgcaggactcattaagaca
tatatcattgaaaaggagcgtatttaa

DBGET integrated database retrieval system