KEGG   Staphylococcus pseudintermedius ED99: SPSE_1373Help
Entry
SPSE_1373         CDS       T02008                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPSE_1373 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSE_1373 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SPSE_1373 (sucB)
Enzymes [BR:sdt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SPSE_1373 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1395251..1396528
Genome map
AA seq 425 aa AA seqDB search
MAEVKVPELAESITEGTIAEWLKQVGDTVEKGEAILELETDKVNVEVVSEEEGTIQELLA
EEGDTVEVGQAIAIVGEGGAATSSSDDSKTDSKNASNKSEQKASDKQEQKEEKSSSDKES
QSSPSNERINATPSARRAAREKGISLSEVSGKANDVVRKEDVERGSQQKSTGAAQSKEKE
AATPQAPKTPSKPVIREKMSRRKQTAAKKLLEVSNNTAMLTTFNEVDMTNVMALRKRKKD
KFMEDHDGTKLGFMSFFTKAAVAALKRYPEVNAEIDGDYMVTKQYYDIGIAVSTPGGLLV
PNVRDCDKKNFAEIEQEIANLASKARDNKLTLDDMMNGSFTITNGGIFGSMMSTPIINGS
QAAILGMHSIITRPVAIDQDTIENRPMMYIALSYDHRIIDGKEAVSFLKMIKELIENPED
LLLES
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtaaaagttccagaattagcagaatcgattacagaaggtaccattgcagaa
tggttaaaacaagtaggtgacactgttgaaaaaggtgaagctatccttgaattagaaaca
gacaaagtgaatgtcgaagtcgtttctgaagaagaaggtacaattcaagagttacttgct
gaagaaggcgacacagtagaagtcggccaagccattgcaatagtgggtgaaggtggcgct
gctacatcttcaagtgatgattcaaaaactgactcaaaaaacgcgtcaaataaatcagaa
caaaaagcgtcagacaaacaagagcagaaagaagaaaaatcatcttctgacaaagaaagc
caaagcagtccttcaaacgaacgcattaatgcaacaccttcagcacgtcgcgcggcacgt
gaaaaaggcattagcttaagcgaagtgagtggcaaagcaaatgatgtcgttcgtaaagaa
gatgttgaacgtggctcacaacaaaaatcaacaggtgctgctcaatctaaagaaaaagaa
gctgctacaccacaagcacctaaaacaccatcaaaaccagtaattcgtgaaaaaatgagt
cgtagaaaacaaactgcagctaaaaaattattagaagtaagcaataacactgcaatgtta
acgacattcaatgaagtagacatgacgaacgtgatggcgctccgaaaacgtaaaaaagac
aaattcatggaagatcatgacggcacgaaacttggcttcatgtcattcttcacaaaagca
gcggttgccgcattgaagcgttaccctgaagtgaacgctgaaatcgatggcgactacatg
gttacaaaacaatactacgatatcggtattgccgtgtctacaccaggcggtttactcgta
ccaaacgttagagattgcgataagaagaactttgctgaaattgagcaagaaattgccaac
ttagcgtcaaaagcacgtgataacaaattgacactggatgacatgatgaacggctcattc
acaattacaaatggtggtattttcggttcaatgatgtcaacaccgattatcaatggtagt
caagctgcaattttaggtatgcactctattattacgagaccggttgcgattgatcaagat
acgattgaaaaccgcccaatgatgtacatcgcattaagttatgaccatagaattatcgac
ggaaaagaagcagtaagtttcttgaagatgattaaagagttaattgaaaaccctgaagat
ttattattagagtcttaa

DBGET integrated database retrieval system