KEGG   Staphylococcus pseudintermedius ED99: SPSE_1442Help
Entry
SPSE_1442         CDS       T02008                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPSE_1442 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPSE_1442 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPSE_1442 (thrC)
Enzymes [BR:sdt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPSE_1442 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1473738..1474802)
Genome map
AA seq 354 aa AA seqDB search
MKLWKGLVEEYKAFLPVDENTPTVTLNEGHTPLIYCDTMSEMLGIELYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKMVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEVAEDGEIELVNSVNPYRIEGQKTSAFEIVEQLDDQAP
DILAIPVGNAGNITAYWKGFKTYEEKYQTGLPHMFGFQAAGAAPIVNNQVVKNPETIATA
IRIGNPASWKQAVQAIEESDGLIEAVTDEEILEAYQLMTSKEGIFSEPASNASIAGLIKL
HRQGKLPQGKKVVAVLTGNGLKDPDTAIGLLENPIQALPNHKESIVQYIKDALK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatggaaaggtcttgttgaagaatacaaagcatttctaccagtagatgaaaac
acaccaacagtgacgttaaatgaagggcatacgccactcatttattgtgacacgatgtca
gagatgttaggcattgaactttatgttaaatatgaaggcgctaatccaactggttcattc
aaagatcgaggcatggtcatggcagtcacaaaagcgaaagagcaaggcaagaaaatggtg
atctgtgcctcgacagggaatacatcagcttctgctgcggcatatgcggcgcgtgcaggt
ttaaaagcgattgtcgttattcctgaaggtaagattgctttaggaaagttatcgcaagct
gttatgtatggtgctgaaatcgtctctattgaaggaaactttgacgaagcgttagaaatc
gttaaagaagttgctgaagatggagaaatcgaattagtcaactcagtcaacccgtatcgt
attgaaggtcaaaaaacgagtgcttttgaaattgttgagcagttagatgaccaagcacca
gatattttagctattccagtaggtaacgccggaaatattactgcatattggaaaggtttt
aaaacgtacgaagaaaaatatcaaacaggcttaccacatatgtttggattccaagcggct
ggtgctgcacctatcgttaacaatcaagtcgttaagaaccctgaaacaatagctacagcg
attcgtatcggtaatcctgcaagttggaagcaagcagttcaagcgattgaagaatctgac
ggtttaattgaagcagtcacagatgaagaaattttagaagcgtatcaactgatgacttct
aaagagggtatttttagcgaacctgcaagtaacgcatcgatagccggacttattaaatta
catcgccaaggaaaattgcctcaaggtaaaaaagtggttgcagttttaactggaaatggt
ttgaaagatccggatacggcgattggtttattagaaaatcctattcaagcattaccaaat
cataaagaaagtatcgttcaatacattaaggacgcgttaaaatga

DBGET integrated database retrieval system