KEGG   Staphylococcus pseudintermedius ED99: SPSE_1696Help
Entry
SPSE_1696         CDS       T02008                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00010  Glycolysis / Gluconeogenesis
sdt00020  Citrate cycle (TCA cycle)
sdt00620  Pyruvate metabolism
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
sdt01200  Carbon metabolism
Module
sdt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSE_1696 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SPSE_1696 (pdhC)
   00620 Pyruvate metabolism
    SPSE_1696 (pdhC)
Enzymes [BR:sdt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SPSE_1696 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N ATP-synt_ab_Xtn DUF896 BSP_II
Motif
Other DBs
NCBI-ProteinID: ADX76951
Position
complement(1736301..1737602)
Genome map
AA seq 433 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLCEVQNDKSVVEIPSPVSGTVLEVL
VEEGTVAVVGDIIVKIDAPDAEEMEFKGGHSNDAPAKAEEAKEEAPQEEAAPAAQEAVEV
DENRQVKAMPSVRKYARDNNVNIKAVNGTGKNGRITKEDVDAYLNGGEQAATAQDTASAE
SSEASTAPAASAPAVSTEGEFPETTEKISAMRKAIAKAMVNSKHTAPHVTLMDEIDVQEL
WDHRKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVQKHYWNIGIA
ADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTSDEMKGATCTISNIGSAGGQ
WFTPVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIK
RLLNNPELLLMEG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatattggtgaaggtatccacgaaggtgaaatcgta
aagtggttcgttaaagctggagacactattgaagaagatgacgtactatgtgaagtacaa
aatgataaatcagttgtagaaatcccatcacctgtaagtggtacagtacttgaagtgtta
gttgaagaaggtactgtagctgttgtaggtgacatcattgttaaaatagatgcacctgac
gctgaagaaatggagttcaaaggcggacatagtaatgatgcgcctgcaaaagctgaagaa
gctaaagaagaagcacctcaagaagaagcggcaccagctgctcaagaagctgtagaagtg
gatgaaaacagacaagtaaaagcaatgccatcagtgcgtaaatatgcacgtgacaataat
gtgaacattaaagctgttaatggtacaggtaaaaatggtagaattactaaagaagatgta
gatgcatacttaaatggtggcgaacaagcagcgacagctcaagatactgcatcagctgaa
tcttcagaagcatcaactgcaccagcagcatcagcaccagcagtttcaactgaaggtgaa
ttccctgaaacaactgagaaaatctctgcaatgcgtaaagcaatcgcaaaagcaatggtg
aactctaagcatactgcacctcacgtaacattaatggacgaaattgatgttcaagagtta
tgggatcaccgtaagaaattcaaagaaattgcggctgaacaaggtactaaattaacattc
ttaccttatgttgttaaagctttagtatcagcattgaaaaaatacccagcacttaacact
tcatttaacgaagaagctggcgaagttgtacaaaaacattactggaacattggtatcgca
gcagacactgacagaggtcttttagtacctgttgttaaacatgctgaccgtaaatcaatc
ttccaaatctcagatgaaattaacgaacttgctgtcaaagctcgtgacggtaaattaaca
tctgacgaaatgaaaggtgcaacatgtacaattagtaacatcggttctgcaggtggccaa
tggttcacaccagttatcaaccacccagaagttgcaatcttaggtattggtcgaatcgct
caaaaaccaatcgttaaagatggcgaaatcgttgcagcacctgtgttagcattatcacta
agctttgaccacagacaaattgatggtgcaactggtcaaaacgcaatgaaccacatcaaa
cgtttattaaacaatccagaactattattaatggaggggtaa

DBGET integrated database retrieval system