KEGG   Staphylococcus pseudintermedius ED99: SPSE_1959Help
Entry
SPSE_1959         CDS       T02008                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00010  Glycolysis / Gluconeogenesis
sdt00051  Fructose and mannose metabolism
sdt00562  Inositol phosphate metabolism
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
sdt01200  Carbon metabolism
sdt01230  Biosynthesis of amino acids
Module
sdt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sdt_M00002  Glycolysis, core module involving three-carbon compounds
sdt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSE_1959 (tpiA)
   00051 Fructose and mannose metabolism
    SPSE_1959 (tpiA)
   00562 Inositol phosphate metabolism
    SPSE_1959 (tpiA)
Enzymes [BR:sdt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPSE_1959 (tpiA)
Exosome [BR:sdt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPSE_1959 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPSE_1959 (tpiA)
  Exosomal proteins of melanoma cells
   SPSE_1959 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADX77205
Position
complement(2014470..2015231)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTVQEAKDFVQTLPALPDTNEVEAVICAPTIQLDALISLTKENVAPG
LKIGAQNTYFEESGAFTGETSPVALEALGVSYVVIGHSERRDLFHETDEDINKKAHAVFN
HNMTPIICVGESDEERESGKANEIVEAQVEKALKGLSDEQIKKVVIAYEPIWAIGTGKSS
TAKDANEMCAAVRQKIAKLTSDEVAQATRIQYGGSVKPGNIKEYMAETDIDGALVGGASL
KVEDYTQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaccaatcatcgcaggtaactggaaaatgaacaaaactgtacaagaagcgaaa
gattttgtacaaacgttaccagcattaccagatacaaatgaagttgaggcagtgatttgt
gcacctacaattcaacttgatgcactgatttcattaacaaaagaaaatgttgcgccaggt
cttaaaatcggtgcgcaaaacacttattttgaagagagtggtgcgtttacaggggaaaca
tctccagtcgcattagaagcattaggtgtgagctacgttgtcatcggtcactctgaacgt
cgtgacttattccacgaaactgatgaagatattaacaaaaaagcgcatgcagtgtttaac
cacaacatgacaccaatcatttgtgtcggtgaatcagatgaagaacgtgaaagtggtaaa
gcaaacgaaatcgttgaagcccaagttgaaaaagcgttaaaaggtttatcagatgaacaa
attaaaaaagttgttatcgcctatgaaccaatttgggcgattggtacaggtaaatcttca
acagcgaaagatgcgaacgaaatgtgtgcagcggtccgtcaaaaaatcgcgaagttaaca
agtgatgaagtagcacaagcaacacgtattcaatacggtggtagtgtaaagccaggcaat
attaaagaatatatggctgaaactgatattgatggcgcattagttggtggtgcatcactt
aaagtagaagattatactcaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system