KEGG   Staphylococcus pseudintermedius ED99: SPSE_2197Help
Entry
SPSE_2197         CDS       T02008                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPSE_2197 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SPSE_2197 (vraB)
   00640 Propanoate metabolism
    SPSE_2197 (vraB)
   00650 Butanoate metabolism
    SPSE_2197 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    SPSE_2197 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SPSE_2197 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPSE_2197 (vraB)
   00310 Lysine degradation
    SPSE_2197 (vraB)
   00380 Tryptophan metabolism
    SPSE_2197 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPSE_2197 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPSE_2197 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPSE_2197 (vraB)
Enzymes [BR:sdt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPSE_2197 (vraB)
Exosome [BR:sdt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPSE_2197 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2254555..2255700)
Genome map
AA seq 381 aa AA seqDB search
MTKAVIVAAKRTPIGVYGGQLQKWEPEHLLKPLFEHFEATLSCSLNDLDDVILGNIVGKG
GNIARKSLLEAGIDVSVPGLTVDRQCGSGLEAIHLASRLVESGAGDFYIAGGVESTSRAP
WKMEKPTSLYPTTPPTFYERAPFAPVGQDPTMIEAADNVAKQYDVSREDQDRFAVQSHHR
ASKAIATGAMSAEILPLIVKGQQMIQDESVKPHLQYERIARLKPLREGGTVTVGNCCLKH
DGACLVVVMSEQKARELGMSEGLMFMDYAVEGVDPHVLGIGPVPAVQRILERQQRTIDQI
DAVELNEAFSAQVLASARALNIQEAQLNRYGGAIAIGHPYSASGAILVTRLFYMKDAQST
IATMGIGGGMGNAALFERWRP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagcagtcattgttgcagcaaaacggacaccaattggcgtgtatggcggtcaa
cttcaaaaatgggagccggagcatctactgaaaccgttattcgaacattttgaagcgaca
ttatcttgttcactcaatgatttagatgacgtcattctcggtaatattgtcggtaaaggg
ggcaatattgcgcgaaaaagtttgctcgaggcagggatagatgtgtctgttccaggtctc
acggttgatcgtcaatgcggttcgggccttgaagcaattcatttggcgagtcgactcgtt
gaaagcggtgcaggagacttttatattgcagggggtgtcgaaagtacgagtcgtgcacct
tggaaaatggaaaagccgacatcactgtatccaacgacacctccgacattttatgagcgt
gcgccatttgcgccagtaggtcaagatccgactatgattgaagcggcagacaacgtggca
aaacagtatgatgtgtcacgtgaagaccaagatcgttttgcggttcaaagccatcatcgt
gcaagtaaagcgattgcgacaggtgcgatgtcagctgaaatattgccactaatagtgaaa
ggtcagcaaatgatacaagatgaaagtgttaagccgcatcttcagtatgagcggattgca
cggttaaagccattacgtgaaggtgggacagtgacagtcggtaattgttgtctcaaacac
gacggcgcctgtctagttgtcgtcatgtctgaacaaaaagcacgcgaactcggtatgtcg
gaaggtctgatgtttatggattatgcggttgaaggggtggatccacatgtattaggcatc
ggtcctgtacccgcagtgcagcgcattttagaacgacaacaacggacgatagaccaaatt
gatgccgtagaattgaatgaagcttttagcgcgcaagtgttagcgtctgcacgtgcgttg
aacattcaagaggcgcaattgaatcgttacggtggtgcgattgcgatcggtcatccgtat
agtgcgagtggtgcgattttagtgacccgtctgttttacatgaaagatgcacaaagtacc
attgcgacaatgggcattggagggggcatgggcaatgcagcactttttgaacgttggcga
ccgtga

DBGET integrated database retrieval system