KEGG   Staphylococcus pseudintermedius ED99: SPSE_2226Help
Entry
SPSE_2226         CDS       T02008                                 

Gene name
dak
Definition
deoxyadenosIne kinase (EC:2.7.1.76)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPSE_2226 (dak)
   00240 Pyrimidine metabolism
    SPSE_2226 (dak)
Enzymes [BR:sdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SPSE_2226 (dak)
    2.7.1.76  2'-deoxyadenosine kinase
     SPSE_2226 (dak)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2283151..2283816
Genome map
AA seq 221 aa AA seqDB search
MNQYNIPSNAIITIAGTVGVGKSSLTRAIAEKLNFRTSYENVEHNPYLDKFYHDFKRWSF
HLQMYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHVEQGTMTPEDFKTYSNLFE
AMVLTPYFPKPDVLIYLESDYEAVLERIQARGRQMEIETNPEYWEMLFQRYENWINQFNA
CPVVRVNINEYDLLSHPESVDVVLKKIGHVIHTYRQVDQRS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatataatataccctcaaacgcgattattaccattgccggtactgtcggtgtt
ggcaaatcatctttaacccgcgcaatagcagaaaaacttaattttagaacatcttatgaa
aatgtagaacataatccctatttagataaattttatcatgatttcaaacgttggagcttt
catttacagatgtactttttagcagaacgctttaaagagcaaaaacgtatgtttgagtat
gggggtggctttgttcaagaccgttcaatttatgaagatgtcgatatctttgcaaagatg
catgtagaacaaggtacgatgacgcctgaagatttcaaaacatactccaacctttttgaa
gcaatggtgttaacaccctatttccctaaacctgacgtcctcatttacctcgagtcagat
tatgaagcagttcttgaacgcatccaagcacgtgggcgtcaaatggaaatcgaaacaaat
cctgaatattgggaaatgctgttccaacgttatgagaattggattaaccaatttaatgct
tgtcctgttgttcgtgtaaatattaatgaatatgatttattgagtcaccctgaatcggtc
gatgtggtattgaaaaaaatcggtcatgtaatccatacctatagacaagtcgatcaacgt
tcataa

DBGET integrated database retrieval system