KEGG   Staphylococcus pseudintermedius ED99: SPSE_2295Help
Entry
SPSE_2295         CDS       T02008                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sdt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2350814..2351299)
Genome map
AA seq 161 aa AA seqDB search
MIDVYLGLGSNMGDREAQLKAAIDLLDAHDKINVVAISPIYETKPVGYTEQPDFLNLCLH
IQTQLSAQDLLKVALETEAELHRVRKVRWGPRTMDIDILLYGDEIIEEDDLTVPHPRMTE
RAFVMVPLNDIAANVTEPHSGQKIQQIVPHDDTVVKYKAIL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtgtatttaggtttaggcagtaacatgggtgaccgagaagcacagttaaaa
gcagcgattgatttattagatgctcatgacaagattaatgttgttgcgatttcacctatt
tatgaaacgaagccggtcggatatacagaacaacctgattttttgaatttatgcttacac
attcaaacacaactttctgcacaagacttgttaaaggtcgctttagaaactgaggcagag
ttacatcgtgtacgtaaagtgcgatggggcccacgtacaatggatattgacattttattg
tacggcgatgaaatcattgaagaggatgatttaacggtgccgcacccgcgtatgactgaa
cgtgcttttgtgatggtaccattaaatgatattgctgccaatgttaccgaaccgcattcg
ggccaaaaaattcaacagatcgtacctcatgatgatacagtagtaaaatataaagcaata
ttgtga

DBGET integrated database retrieval system