KEGG   Streptomyces davawensis: BN159_0342Help
Entry
BN159_0342        CDS       T02518                                 

Gene name
xlnA1
Definition
Endo-1,4-beta-xylanase A (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sdv  Streptomyces davawensis
Brite
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     BN159_0342 (xlnA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
367625..369055
Genome map
AA seq 476 aa AA seqDB search
MGSYALPPPPVRHRLSRLLTALAVGILSVVGALVAPPTAHAAESTLGAAAAQSGRYFGTA
IASGRLGDSAYTTIAGREFNSVTAENEMKIDATEPQRGQFNFTAADRVYNWAVQNGKQVR
GHTLAWHSQQPGWMQNLSGSTLRQAMIDHINGVMSHYKGKIAQWDVVNEAFADGSSGARR
DSNLQRTGNDWIEVAFRTARAADPAAKLCYNDYNVENWTWAKTQAMYAMVRDFKQRGVPI
DCVGFQSHFNSGSPYNSNFRTTLQNFAALGVDVAITELDIQGAPASTYAAVTNDCLAVPR
CLGITVWGVRDTDSWRAEQTPLLFNGDGSKKPAYTAVLNALNGGSTTPPSDSGPIRGVAS
GRCLDVPGAVTTDGTQLQLWDCHNGTNQQWTYTAAGELRVYGNKCLDAAGTGNGTKVQIY
SCWGGDNQKWRLNSDGSIVGVQSGLCLDAAGAGTANGTLIQLYTCSNGSNQRWTRT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgtacgcccttcccccacccccagtccgccacaggctcagcaggctgctgaca
gcgctggccgtcggcatcctcagtgtggtcggtgcactggtcgcgccgccgacggcacac
gccgccgagagcacgctcggcgccgcggccgcgcagagcggccgctacttcggcaccgcc
atcgcgtccggcaggctgggcgactcggcgtacacgacgatcgcgggccgtgagttcaac
tcggtgaccgccgagaacgagatgaagatcgacgccaccgaaccgcagcggggccagttc
aacttcaccgccgccgaccgcgtctacaactgggcggtgcagaacggcaaacaggtgcgc
ggccacaccctggcctggcattcccagcagcccggctggatgcagaacctcagcggcagc
accttgcgccaggcgatgatcgaccacatcaacggcgtgatgagccactacaaaggcaag
atcgcccagtgggacgtcgtgaacgaggccttcgccgacggcagttcgggagcccggcgc
gactccaaccttcagcgcaccggcaacgactggatcgaggtcgccttccgcaccgcacgc
gccgcggacccggccgcgaagctctgctacaacgactacaacgtcgagaactggacctgg
gccaagacccaggcgatgtatgccatggtccgggacttcaagcagcgcggcgtgccgatc
gactgcgtcggcttccagtcgcacttcaacagcggcagcccctacaacagcaacttccgc
accacccttcagaacttcgccgctctcggcgttgacgtggccatcaccgaactcgacatc
cagggtgccccggcctcgacctacgccgccgtgaccaacgactgcctggccgtcccgcgc
tgcctcggcatcaccgtctggggtgtgcgcgacaccgactcctggcgagcggagcagacg
ccgctgctgttcaacggcgacggcagcaagaagcccgcctacacggccgtactcaacgcg
ctcaacggcggctccaccacgccgccttcggattccggaccgatcaggggggtcgcttca
ggccgctgcctggacgtgcccggcgccgtcaccaccgacggcacccaactccagctgtgg
gactgccacaacggcaccaaccagcagtggacgtacaccgccgcaggcgagctcagggtc
tacggcaacaagtgcctggacgccgccggaaccggcaacggcaccaaagtccagatctac
agctgctggggcggcgacaaccagaaatggcgtctcaactccgacggatccatcgtcggc
gtccaatccggcctctgcctcgacgccgccggagccggcaccgccaacggcaccctgatc
cagctctacacctgctcgaacggcagcaaccaacgctggacccgcacctga

DBGET integrated database retrieval system