KEGG   Streptomyces davawensis: BN159_0717Help
Entry
BN159_0717        CDS       T02518                                 

Gene name
icl
Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sdv  Streptomyces davawensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN159_0717 (icl)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BN159_0717 (icl)
Enzymes [BR:sdv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BN159_0717 (icl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
779431..780714
Genome map
AA seq 427 aa AA seqDB search
MAEARTRAAEELARRWATDPRWQGIERTYTAQDVIRLSGSVREEHTLARRGAERLWRQLH
ERDYVHALGALTGGQAVQQVKAGLQAIYLSGWQVAADANQAGHTYPDQSLYPANSVPQVV
RRINNALMRADQIAAAENTGDTTDWLAPIVADAEAGFGGPLNAFELTKAMIAAGAAGIHY
EDQLASEKKCGHLGGKVLVPTSQHIRTLNAARLAADIADVPTVIVARTDALAANLLTTDV
DERDAEFVTGERTAEGFYRVRNGMAPVIARGLAYAPYADLIWVETGTPDLAQAREFAEAI
HARYPDRMLAYNCSPSFNWRAALDDDQIAKFQRELGAMGYRFQFITLAGFHSLNHGMFDL
ARGYAEHGMTAYVDLQEREFAAQEHGFTAVKHQREVGTGYFDLVSTAVNPASSTTALAGS
TEEEQFH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcgaggacgcgggcggccgaggaactcgcgcggcgctgggccaccgaccca
cggtggcagggcatcgagcgcacctacacggctcaggacgtgatccgcctgtccggcagc
gtccgtgaggaacacaccctggcccgccggggcgccgagcggctctggcgtcagctgcac
gagcgggactacgtccacgcgctcggcgcgctcaccggcgggcaggccgtccagcaggtg
aaggccgggctccaggcgatctacctgtccggctggcaggtcgccgccgatgccaaccag
gccggtcacacctaccccgaccagagcctgtacccggccaactcggtgccgcaggtggtc
cgtcgtatcaacaacgccctcatgcgcgccgaccagatagccgccgccgagaacaccggg
gacaccacggactggctcgcgccgatcgtcgccgacgccgaggccgggttcggcggtccg
ctgaacgccttcgagctgaccaaggcgatgatcgcggccggggcggccggcatccactac
gaggaccagctcgcctcggagaagaagtgcggccaccttggcggcaaggtgctcgtgccc
acctcccagcacatccgcaccctcaacgcggcccgcctcgccgccgacatcgccgacgtc
ccgacggtgatcgtcgcccgtacggacgccctggcggccaacctcctcaccaccgatgtc
gacgagcgtgacgcggagttcgtcaccggcgagcggaccgccgagggtttctaccgggtc
cgcaacggcatggccccggtcatcgcccgcggcctggcctacgccccgtacgccgacctg
atctgggtggagaccggcacacccgacctcgcccaggcccgtgagttcgccgaggcgatc
cacgcgcggtacccggatcggatgctcgcctacaactgctcgccctccttcaactggagg
gccgcgctggacgacgaccagatcgccaagttccagcgggagctgggggcgatgggctac
cggttccagttcatcaccctggccgggttccactccctcaaccacggcatgttcgatctc
gcccgcggctacgccgagcacggcatgaccgcctacgtcgacctccaggagcgggagttc
gcggcccaggagcacggcttcaccgcggtaaagcaccaacgcgaggtcggcaccggttac
ttcgacctcgtctccaccgccgtgaaccccgcgtcgtcgacgaccgcgctcgccgggtcc
acggaggaagagcagttccactag

  All links  
No link information was found.   
DBGET integrated database retrieval system