KEGG   Streptomyces davawensis: BN159_0786Help
Entry
BN159_0786        CDS       T02518                                 

Gene name
cex1
Definition
Exoglucanase/xylanase (EC:3.2.1.91)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sdv  Streptomyces davawensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(849641..851020)
Genome map
AA seq 459 aa AA seqDB search
MAPRTTIRKAPERPHPRPRTALILGLAGLLAATGVTALTGTAQAASTLGAAAAEKGRYFG
TAVAANHLGESAYANTLNTEFNSVTPENEMKWDAVEPSRGSFSYGSADQIVNHAQSRGMK
VRGHTLVWHSQLPSWVGSLATADLRSAMNNHITQVMTHWKGKIHSWDVVNEAFQDGSSGA
RRSSPFQDKLGNGFIEEAFRTARAADPAAKLCYNDYNTDGVNAKSNAVYNMVRDFKARGV
PIDCVGFQSHFNSASPVPSDYQANLQRFADLGVDVQITELDIEGSGTAQANSYSNVVRAC
LAVSRCTGITVWGVTDKYSWRASGTPLLFDGNYAKKPAYTAVLTALGGSGGGGGGGGTAS
CSVTYSKAEEWNDGFNGRVTVTAGSSAITSWTTTVTVTSPQKISATWNGSPTWDSSGNVM
TMRPNGNGSLAAGASTSFGFTVMKNGNNSAPVLGSCTAS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggccccccgcacgaccatccgcaaggcccccgaacgtccgcacccccgcccgcgcacc
gcactcatcctcggcctcgccggcctgctcgccgccaccggtgtcaccgctctgacgggc
accgcgcaggcggcgagcaccctcggcgcggcggccgccgagaagggccgctacttcggc
accgccgtcgccgccaaccacctcggtgagtccgcgtacgcgaacacgctcaacaccgag
ttcaactcggtcacccccgagaacgagatgaagtgggacgccgtcgagcccagccgcggc
tcgttctcctacggcagcgccgaccagatcgtcaaccacgcccagagccggggcatgaag
gtccgcggccacaccctggtgtggcactcccaactgcccagctgggtcggttcgttggcc
accgccgacctcagatcggcgatgaacaaccacatcacccaggtgatgacccactggaag
ggcaagatccactcctgggacgtcgtcaacgaggccttccaggacggctccagcggagcc
cgccgcagctcgcccttccaggacaagctcggcaacggcttcatcgaggaggcgttccgc
accgcccgcgccgccgacccggccgccaagctctgctacaacgactacaacaccgacggc
gtcaacgcgaagagcaatgccgtctacaacatggtccgcgacttcaaggcgcgcggcgtg
ccgatcgactgcgtcggcttccagtcccacttcaacagcgcctcacccgtgccctccgat
taccaggcgaatctccagcgtttcgccgatctcggcgtcgacgtccagatcaccgaactc
gacatcgagggctccggcaccgcccaggccaacagctacagcaatgtcgtacgggcctgc
cttgccgtgagccgctgcaccggcatcactgtctggggcgtcaccgacaagtactcctgg
cgtgcctccggaacacccctgctgttcgatggcaactacgccaagaagcccgcctatacg
gccgtactgaccgcgctcggcggatccggtggaggcggcggcggtggcgggaccgcgtcc
tgctccgtgacgtacagcaaggcggaggaatggaatgacggcttcaacggcagggtgacc
gtcaccgcgggcagttcggccatcacgagttggacgacgaccgtcacggtcacctcaccc
cagaagatctccgcgacctggaacggctcgcccacctgggacagttccggcaacgtgatg
acgatgcgtccgaacggcaacggcagcctcgccgccggggcgtcgaccagcttcggcttc
accgtgatgaagaacggcaacaactcggcgccggtgctgggttcctgtacggcgtcctga

DBGET integrated database retrieval system