KEGG   Streptomyces davaonensis: BN159_1019Help
Entry
BN159_1019        CDS       T02518                                 

Gene name
strM
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00521  Streptomycin biosynthesis
sdv00523  Polyketide sugar unit biosynthesis
sdv01130  Biosynthesis of antibiotics
Module
sdv_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BN159_1019 (strM)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN159_1019 (strM)
Enzymes [BR:sdv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BN159_1019 (strM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CCK25398
UniProt: K4QWJ9
Position
1101012..1101659
Genome map
AA seq 215 aa AA seqDB search
MRALGIDGAWVLEPKVFPDDRGSFHEWYRSEEFREATGYDLTLAQANCSVSRRGVVRGVH
FSDVPPGQAKYVTCVRGTVLDVVVDLRTGSPAFGQWEAVRLDDDTRHAVFLAEGLGHAFM
ALTDDATVVYLCSTGYAPDREHGVHPLDPDLALPWPESVAPVLSPKDAEAPTLAEALRTG
LLPSYEDCAARYRSLRDGQGLEPPERPIDPPSAGA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgcactgggaatcgacggagcctgggtgctggagcccaaggtgttcccggacgac
cggggcagcttccacgagtggtaccgcagcgaggagttccgcgaggccaccggctacgac
ctcacgctcgcgcaggccaactgctccgtctcccggcggggcgtggtgcgcggggtgcac
ttctccgatgtgccgcccggccaggccaagtacgtcacctgtgtgcgcggcaccgtgctg
gacgtggtggtcgatctgcgcaccggctccccggcgttcggccagtgggaggcggtgcgc
ctggacgacgacacccggcacgcggtcttcctggcggagggcctgggccacgccttcatg
gcgctcaccgacgacgcgaccgtcgtctatctgtgctccaccggctatgccccggaccgg
gagcacggcgtgcacccgctcgacccggacctcgccctgccctggcccgagagcgtggcg
ccggtgctctccccgaaggacgccgaggccccgaccctggccgaggccctgcgcaccggc
ctcctgccgtcgtacgaggactgcgccgcccgctaccggtcgctgcgggacggccagggc
ctggaaccacccgagaggccgatcgacccgccctcggccggggcttga

DBGET integrated database retrieval system