KEGG   Streptomyces davaonensis: BN159_1389Help
Entry
BN159_1389        CDS       T02518                                 

Definition
(GenBank) Acetaldehyde dehydrogenase 2
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00360  Phenylalanine metabolism
sdv00362  Benzoate degradation
sdv00620  Pyruvate metabolism
sdv00621  Dioxin degradation
sdv00622  Xylene degradation
sdv00650  Butanoate metabolism
sdv01100  Metabolic pathways
sdv01120  Microbial metabolism in diverse environments
sdv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN159_1389
   00650 Butanoate metabolism
    BN159_1389
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BN159_1389
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN159_1389
   00622 Xylene degradation
    BN159_1389
   00621 Dioxin degradation
    BN159_1389
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BN159_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA CoA_binding DUF4242
Motif
Other DBs
NCBI-ProteinID: CCK25768
UniProt: K4QXJ1
Position
complement(1507455..1508399)
Genome map
AA seq 314 aa AA seqDB search
MSRTKVAVIGSGNIGTDLMIKVLRGSRHLEMGAMVGIDPASDGLARAARLGVPITHEGVD
GLLALPGFDDIEIVFDATSAKAHEVNAAKLLPLGKRLIDLTPAAIGPYVVPAVNLDEHLD
APDVNMVTCGGQATIPVVAAVGRVVPVAYAEIIASIASKSAGPGTRANIDEFTETTSAAI
ERVGGARRGKAIIVLNPAEPPLMMRDTVFCLVTAPDPAMHEEIRRSVEKMVADVAAYVPG
YRLKQQVQITEIPADQPVGTLLPGSDARPTHQVSVFLEVEGAAHYLPAYAGNLDIMTSAG
LQAAERIAARKAGR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggacgaaggtcgcggtcatcggctcgggcaatatcggcaccgacctgatgatc
aaggtgctgcggggttcacgtcacctggagatgggagccatggtcggcatcgaccccgcc
tcggacgggctggcccgcgccgcccggctcggggtgcccatcacccacgagggcgtggac
gggctcctcgcgctgccgggcttcgacgacatcgagatcgtcttcgacgccacctccgcc
aaggcccacgaggtgaacgccgccaagctgctcccgctcgggaagcggctgatcgacctg
accccggccgcgatcggcccgtacgtcgtcccggccgtcaacctcgacgagcacctggac
gcgcccgacgtcaacatggtcacctgcggcggccaggccaccatccccgtcgtcgccgcg
gtcggccgggtcgtgccggtcgcgtacgccgagatcatcgcgtcgatcgcgtcgaagtcg
gcgggccccggcacccgcgccaacatcgacgagttcaccgagaccacctcggccgccatc
gagcgggtcggcggcgcgcgccgcggcaaggcgatcatcgtgctcaacccggccgagccg
ccgctgatgatgcgggacacggtcttctgcctggtcacggcgccggacccggccatgcac
gaggagatcaggcggtcggtggagaagatggtcgccgacgtcgccgcgtacgtccccggc
taccgcctcaagcagcaggtgcagatcaccgagatccccgccgaccagcccgtggggacc
ttgctgcccggctccgacgcccgccccacccaccaggtgtcggtcttcctggaggtcgag
ggcgccgcccactacctcccggcctacgccggaaacctcgacatcatgacctccgccggc
ctccaggccgcggagcggatcgcagcacggaaggcgggccgctga

DBGET integrated database retrieval system