KEGG   Streptomyces davawensis: BN159_1389Help
Entry
BN159_1389        CDS       T02518                                 

Definition
Acetaldehyde dehydrogenase 2 (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
sdv  Streptomyces davawensis
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BN159_1389
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN159_1389
   00650 Butanoate metabolism
    BN159_1389
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BN159_1389
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN159_1389
   00622 Xylene degradation
    BN159_1389
   00621 Dioxin degradation
    BN159_1389
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BN159_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1507455..1508399)
Genome map
AA seq 314 aa AA seqDB search
MSRTKVAVIGSGNIGTDLMIKVLRGSRHLEMGAMVGIDPASDGLARAARLGVPITHEGVD
GLLALPGFDDIEIVFDATSAKAHEVNAAKLLPLGKRLIDLTPAAIGPYVVPAVNLDEHLD
APDVNMVTCGGQATIPVVAAVGRVVPVAYAEIIASIASKSAGPGTRANIDEFTETTSAAI
ERVGGARRGKAIIVLNPAEPPLMMRDTVFCLVTAPDPAMHEEIRRSVEKMVADVAAYVPG
YRLKQQVQITEIPADQPVGTLLPGSDARPTHQVSVFLEVEGAAHYLPAYAGNLDIMTSAG
LQAAERIAARKAGR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggacgaaggtcgcggtcatcggctcgggcaatatcggcaccgacctgatgatc
aaggtgctgcggggttcacgtcacctggagatgggagccatggtcggcatcgaccccgcc
tcggacgggctggcccgcgccgcccggctcggggtgcccatcacccacgagggcgtggac
gggctcctcgcgctgccgggcttcgacgacatcgagatcgtcttcgacgccacctccgcc
aaggcccacgaggtgaacgccgccaagctgctcccgctcgggaagcggctgatcgacctg
accccggccgcgatcggcccgtacgtcgtcccggccgtcaacctcgacgagcacctggac
gcgcccgacgtcaacatggtcacctgcggcggccaggccaccatccccgtcgtcgccgcg
gtcggccgggtcgtgccggtcgcgtacgccgagatcatcgcgtcgatcgcgtcgaagtcg
gcgggccccggcacccgcgccaacatcgacgagttcaccgagaccacctcggccgccatc
gagcgggtcggcggcgcgcgccgcggcaaggcgatcatcgtgctcaacccggccgagccg
ccgctgatgatgcgggacacggtcttctgcctggtcacggcgccggacccggccatgcac
gaggagatcaggcggtcggtggagaagatggtcgccgacgtcgccgcgtacgtccccggc
taccgcctcaagcagcaggtgcagatcaccgagatccccgccgaccagcccgtggggacc
ttgctgcccggctccgacgcccgccccacccaccaggtgtcggtcttcctggaggtcgag
ggcgccgcccactacctcccggcctacgccggaaacctcgacatcatgacctccgccggc
ctccaggccgcggagcggatcgcagcacggaaggcgggccgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system