KEGG   Streptomyces davawensis: BN159_1716Help
Entry
BN159_1716        CDS       T02518                                 

Definition
(RefSeq) DNA polymerase LigD, ligase domain-containing protein
Organism
sdv  Streptomyces davawensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1879117..1880181
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMQYEAKWDGFRAIVFRDGAEVELGSRTTKSLTRYFPE
LVEALKERVPERCVLDGEIVIAREWRLDFDALTERIHPAASRVRTLAERTPASFVAFDLL
ALADESLLDVELTDRRALLTRALARATPPVHVAPATTDVEVARQWFEQYEGAGLDGVIAK
PLTSRYLPDERAMFKIKHERTADVVVAGYRLHKSGPIVGSLLLGLYDDRGALQHVGVSAA
FAMKVRAQLIEELEPLRMDDTTGHPWAAWAEEAAHESARLPGAPSRWSGKKDLSWVPLRP
ERVCEVAYDHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLDEILGG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggaccttccggtgatgccgcccgtgaagccgatgctcgccaagtcggtggcgaagatc
ccgccgggcatgcagtacgaggccaagtgggacgggttccgggcgatcgtgttccgcgac
ggcgccgaggtcgagttgggcagccgtaccaccaagtcgttgaccaggtacttcccggag
ctggtggaggcgctcaaggagcgggtgcccgagcggtgcgtgctggacggggagatcgtg
atcgcccgggagtggcggctggacttcgacgcgctcaccgagcggatccacccggcggcc
tcccgcgtacggacgctggccgagcggaccccggcctccttcgtggccttcgatctgctg
gcgctggcggacgagtcgctgctggacgtggagctgaccgatcgcagggcgctgctgacc
agggcgctcgcgagggcgacgccaccggtgcacgtggcgcccgcgacaaccgacgtcgag
gtggcccggcagtggttcgagcagtacgagggcgccggtctggacggggtgatcgccaag
ccgctgacctcgcggtatctcccggacgagcgcgccatgttcaagatcaagcacgagcgc
acggccgatgtggtcgtggccggttaccggctgcacaagagcggaccgatcgtcggctcg
ctgctgctcggtctgtacgacgaccggggcgccctccagcacgtgggagtctccgccgcc
ttcgccatgaaggtgcgcgcccagctgatcgaggagctggagccgctgcgcatggacgac
accacgggacatccctgggcggcatgggccgaggaggcggcgcacgagtcggcccggctg
ccgggggcaccgagccgctggtccggaaagaaggacctgtcctgggtgccgctgaggccg
gagcgggtgtgcgaggtggcctacgaccacatggagaacggggcacgcttccggcacacc
gcccggttccgccgctggcgcccggaccggacgccggagagctgcacgtacgcccagctg
gaggagccggtccggtacgacctggacgagatcctcggcggctga

DBGET integrated database retrieval system