KEGG   Streptomyces davaonensis: BN159_1745Help
Entry
BN159_1745        CDS       T02518                                 

Gene name
cypD
Definition
(GenBank) putative bifunctional P-450/NADPH-P450 reductase 1
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00071  Fatty acid degradation
sdv00380  Tryptophan metabolism
sdv00627  Aminobenzoate degradation
sdv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BN159_1745 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BN159_1745 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BN159_1745 (cypD)
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BN159_1745 (cypD)
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BN159_1745 (cypD)
Cytochrome P450 [BR:sdv00199]
 Cytochrome P450, bacteria type
  CYP102 family
   BN159_1745 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1 SIS_2
Motif
Other DBs
NCBI-ProteinID: CCK26124
UniProt: K4R0F3
Position
complement(1912819..1916040)
Genome map
AA seq 1073 aa AA seqDB search
MATQPVTDLRPIPSPRGIPLLGNTPQIPDTNPVEYFAELSMQFPDGIYGLDIAGIEQIFV
YDPDLVAEVSDETRFFKQIEKTPLQHVRDFAGAGLFTAHQHEEEWGMAHRILLPAFSQRA
MRAYYGQMLEIAQNLVGKWERKAGQPVNITDDYTRLTLDTIALSGFGYRFDSFDKEELHP
FLNALLGALIESLRRSQELPMMTKLRKADAKKYGENVQLMQELVESVIKERREGKGTGEE
DLLGLMLEATDPETGNRLYDDNVRDQVLTFLIAGHETTSGLLAFATYSLMRNPHALAQAY
AEVDRLLPGDTVPDYDTIMQLDVIPRILDETLRLWAPIPSFGKTAREDTVIGGRYELKKG
AKVLILEGPLHTHPKAWDRPDEFDIDRWLPENRVQHHPHGYKPFGNGVRACIGRQFALTE
ARLALALVLQKFKFSDTNDYKMDPREALTRKPGNFELIVRRRQEHERTVFGAADVQTGDT
QAPAAVSGVGVNLTVAYGSSLGSCEDLARTIADRGERSSFGTTLVSLDELGDNLPSEGLL
AVVAASYNGKAPDNAQRFDDLIAAGLPEGSLSNVRFALLGAGNTQWVATYQAFPQRIEAA
LLAAGATPVVERGIADAAGDFDGMASRWMDGLWATLAEEYAADTSDDGGPRYEVQLLTEA
DVRPAIVSEQAYPLTVVANEELVSDATGLWDFSIEPPRPSAKSLTIELPEGVTYDTGNHL
AVFAKNEPALVDRALARLGVDRDQVLRLQQPAGGRTHLPVGTPVTAGLLLTEFLELQDLA
TRSQIQTLAEHTECPWTRPQLEAYTADTEEAGQRYQEEILEKRVSVLTLLERFPAVELPL
AVFLEMMGPIRPRFYSISSSPLASPRQVRLTVGLLEGPALSGDGQYRGTCSSYMARLEPG
DVVYGYVRVPSPTFAPPADPTTPLILIGPGTGIAPLRGFLEERARQYENGTEVGLSQVFV
GCRHPQHDYFYRDEMEMWELSGVARVHTAFSAVTGHPARFVQNAIAGAAGTVWQALQDGA
YVYVCGDGRRMAPAVREALAAVHREHTGGDDEAAQRWLAQLEADERYQQDVFA
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcaacccgtgactgatctgcgtcccatcccgtccccgcgcgggatccccctg
ctcggcaacacgccgcagatccccgacaccaacccggtcgagtacttcgccgagctgtcc
atgcagttccccgacggcatctacggcctggacatcgccggtatcgagcagatcttcgtc
tacgacccggacctggtggccgaggtctccgacgagacgcggttcttcaagcagatcgag
aagacgccgctgcagcatgtccgggacttcgcgggcgcgggtctgttcacggcccaccag
cacgaggaggaatggggcatggcgcaccggatcctcctgccggcgttcagccagcgggcc
atgagggcctactacgggcagatgctggagatcgcccagaacctggtgggtaagtgggag
cgcaaggcgggtcagccggtcaacatcaccgacgactacacccggctgacgctggacacc
atcgccctgtcggggttcggctaccggttcgactccttcgacaaggaggagctgcacccc
ttcctcaacgcgctgctgggcgcgctgatcgagtcgctgcggcgctcgcaggagctgccg
atgatgaccaagctccgcaaggccgatgccaagaagtacggcgagaacgtccagctgatg
caggagctggtcgagagcgtgatcaaggagcgccgcgaggggaagggcaccggtgaggag
gacctgctgggcctgatgctggaggccaccgaccccgagaccggcaatcggctgtacgac
gacaacgtccgcgaccaggtgctgacgttcctgatcgccggccacgagaccaccagcggc
ctgctggcgttcgccacgtactcgctgatgcgcaacccgcacgcgctggcccaggcctac
gccgaggtggaccgcctgctgcccggcgacaccgtcccggactacgacacgatcatgcag
ctggacgtcatcccgcggatcctggacgagaccctgcgcctgtgggctcccatcccgtcg
ttcggcaagacggcgcgggaggacaccgtcatcggcggccgctacgagctgaagaagggc
gcgaaggtcctcatcctcgagggcccgctgcacacccaccccaaggcgtgggaccggccg
gacgagttcgacatcgaccgctggctgccggagaaccgcgtccagcaccacccgcacggc
tacaagccgttcggcaacggcgtacgtgcctgcatcggccgccagttcgcgctcaccgag
gcccgcctggccctcgcgctggtgctgcagaagttcaagttctccgacaccaacgactac
aagatggacccccgggaggcgctgacgcgcaagcccggcaacttcgagctgatcgtccgc
cgtcgtcaggagcacgagcggaccgtcttcggcgctgcggacgtgcagaccggggacacg
caggcgccggcagcggtcagcggtgtcggggtgaacctgaccgtcgcctacggctccagc
ctgggttcgtgcgaggacctggcgcgcaccatcgccgaccgaggtgagcgctccagcttc
ggcaccacgctggtgagcctggacgagctgggtgacaacctgccctccgagggtctgctt
gccgtcgtcgccgccagctacaacggcaaggcgcccgacaacgcccagcgcttcgacgac
ctgatcgccgccgggctgcccgagggctcgctgtcgaacgtgcggttcgcgctgctgggc
gccggcaacacccagtgggtggcgacctatcaggcgttcccccagcggatcgaggccgcc
ctgctggccgccggcgccacccccgtcgtcgagcgcggtatcgccgacgccgccggtgac
ttcgatggcatggcgagtcgctggatggacggcctgtgggccactctggccgaggaatac
gccgccgacacctccgacgacggcgggccgcgctatgaagtgcagctgctgaccgaggcg
gatgtgcgcccggcgatcgtctccgagcaggcttacccgctgacggtggtggccaacgag
gagctcgtgtccgacgcgaccgggctgtgggacttcagcatcgagccgccgcgcccgtcc
gcgaagtccctcaccatcgagctgcccgagggcgtcacctacgacaccggcaaccacctg
gccgtcttcgccaagaacgagcccgcgctggtcgaccgcgccctggcccggctgggcgtc
gaccgcgaccaggtgctcaggctgcagcagcccgcgggcggccggacgcacctgccggtg
ggtacgcccgtcaccgcgggtctgctgctcaccgaattcctggaactgcaggacctggcc
acccgctcccagatacagaccctggccgagcacaccgagtgcccttggacccggccgcag
ttggaggcgtacacggccgacaccgaggaagccggacagcggtaccaggaggagatcctc
gagaagcgtgtctcggtgctcaccctcctggagcgcttccccgcggtcgaactgccgctc
gcggtgtttctggagatgatgggcccgatccgtccgcgcttctactccatctcctcctcc
ccgctggccagtccgcgccaggtgcgcctgaccgtcggcctgctggaaggcccggccctg
tccggcgacggacagtaccgcggcacctgctcctcctacatggcgcggttggagccggga
gacgtcgtctacggctacgtccgcgtgccctccccgaccttcgccccgcccgccgacccc
acgacaccgctgatcctcatcggccccggcaccggcatcgcaccgctgcgcggcttcctg
gaggaacgtgcccggcagtacgagaacggcacggaggtgggcctgtcccaggtgttcgtc
ggctgccgccacccgcagcacgactacttctaccgggacgagatggagatgtgggagctg
tccggcgtcgcccgggtccacaccgccttctccgcggtgaccggccacccggcccggttc
gtacagaacgccatcgcgggcgccgccggcaccgtgtggcaggcgcttcaggacggtgcc
tacgtctacgtctgcggtgacggccgccgcatggcgcccgccgtccgcgaggcgctcgcc
gcggtccaccgcgagcacaccggcggcgacgacgaggccgcccagcgatggctcgcccag
ctggaagccgacgagcgctaccagcaggacgtcttcgcctga

DBGET integrated database retrieval system