KEGG   Streptomyces davawensis: BN159_2080Help
Entry
BN159_2080        CDS       T02518                                 

Gene name
yfbQ
Definition
putative aminotransferase YfbQ (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sdv  Streptomyces davawensis
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    BN159_2080 (yfbQ)
   01230 Biosynthesis of amino acids
    BN159_2080 (yfbQ)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN159_2080 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    BN159_2080 (yfbQ)
Enzymes [BR:sdv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BN159_2080 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     BN159_2080 (yfbQ)
Amino acid related enzymes [BR:sdv01007]
 Aminotransferase (transaminase)
  Class I
   BN159_2080 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2308884..2310092
Genome map
AA seq 402 aa AA seqDB search
MEFRQSNKLSEVCYEIRGPVIEHADALEKAGHSVLRLNTGNPALFGFEAPEEILQDMIRM
LPQAHGYTDSRGVLSARRAVAGRYQNLGLEVDVDDVFLGNGISELISMAVTALVEDGDEI
LIPAPDFPLWTAVTTLAGGKPVHYLCDEQADWYPDLEDMASKITDRTKAVVIINPNNPTG
AVYPKEIIEGILDLARRHGLMVFADEIYDQILYDDAVHHSVAALAPDLVVLTFCGLSKTY
RVAGFRSGWLVVTGPKQHARNYLEGLTMLASMRLCANAPAQYAIQAALGGRQSITELTAP
GGRLHEQRNVAWEKLNEIPGVSCVKPKGSLYAFPRLDPKVHKIHDDEKFVLDLLLREKIQ
VVQGTGFNWPTPDHFRILTLPHAEDLEAAIGRIGRFLGGYRQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagttccggcagtcgaacaagctcagcgaggtctgttacgagatccgcggcccggtg
atcgagcacgccgacgcgctggagaaggccggccacagcgtcctgcgcctgaacaccggc
aaccccgcgctgttcggcttcgaggcgccggaggagatcctccaggacatgatccggatg
ctcccgcaggcgcacggctacaccgactcccggggcgtcctctccgcgcgccgggccgtc
gcggggcgctaccagaacctgggcctcgaggtggacgtcgacgacgtcttcctcggcaac
ggcatctccgagctgatctcgatggccgtgaccgcgctggtcgaggacggcgacgagatc
ctcatcccggcccccgacttccccctctggacggccgtcaccacgctcgcgggcggcaag
ccggtgcactacctctgcgacgaacaggccgactggtacccggacctggaggacatggcg
tcgaagatcacggaccgcaccaaggccgtggtcatcatcaacccgaacaaccccacgggc
gccgtctaccccaaggagatcatcgagggcatcctcgacctcgcccgccggcacggcctg
atggtcttcgcggacgagatctacgaccagatcctctacgacgacgcggtccaccactcg
gtcgcggcgctggcccccgacctggtcgtcctgaccttctgcggcctgtcgaagacctac
cgggtggcgggcttccgctcgggctggctggtcgtcaccggcccgaaacagcacgcccgg
aactacctggagggcctgaccatgctggcctccatgcggctgtgcgccaacgcgcccgcg
cagtacgccatccaggccgcgctgggcggccgccagtcaatcaccgagctgaccgcgccg
ggcggacgcctgcacgaacagcggaacgtggcctgggagaagctcaacgagatccccggg
gtgtcgtgcgtgaagccgaagggctccctgtacgcgttcccccgactggaccccaaggtc
cacaagatccacgacgacgagaagttcgtcctggacctgctcctgcgggagaagatccag
gtcgtccagggcaccggcttcaactggcccacccccgaccacttccgcatcctcaccctc
ccgcacgccgaggacctggaggcggcgatcggccggatcgggcggttcctgggcgggtac
cggcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system