KEGG   Streptomyces davaonensis: BN159_2385Help
Entry
BN159_2385        CDS       T02518                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00860  Porphyrin and chlorophyll metabolism
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN159_2385
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BN159_2385
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BN159_2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO HI0933_like FAD_binding_2 Pyr_redox_2 Pyr_redox NAD_binding_9 AlaDh_PNT_C FAD_oxidored Thi4 Lycopene_cycl Pyr_redox_3 FAD_binding_3 GIDA NAD_binding_7 MCRA FMO-like
Motif
Other DBs
NCBI-ProteinID: CCK26764
UniProt: K4R261
Position
complement(2670063..2671535)
Genome map
AA seq 490 aa AA seqDB search
MHAADTDSDTPAERGHVVVIGAGIAGLAAAHRLLAEGRRVTVLEAADRVGGKLLPGEIAG
VRVDLGAESMLARRPEAVGLAREVGLAERLQPPATATASLWTRGALRPMPKGHVMGVPGT
AAALAGVLSDEGLARIERDTELPRTEVGEDVAVGAYVAERLGREVVDRLVEPLLGGVYAG
DAYRISMRSAVPQLFQAAQTHDSLTEAVREIQAKAAAHQQQSGPVFMGIQGGIGTLPLAV
AESVRARGGEIVTGAPVTGLRRAPDGWRIVTGGRTLRADAVVIAVPAPVAAGLLRAEVPA
AAAELTAVEYASMALITLAYRRAGTALPEGSGFLVPPVDGHTIKASTFASRKWGWIAEED
PDLLVLRTSVGRYGETEILQRDDAALVDVSRHDLKAATGLDATPVATRVTRWTEGLPQYP
VGHHARVARIREHLGRVPGLAVCGAAYDGVGIPACIASAHAAVDQIHGDLRAVQELTANP
VQSLHGGAGE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcagcggacacggattcggacactccagcggaacgcggacatgtcgtcgtcatc
ggcgccgggatcgccggcctcgcggccgcgcatcggctgctcgccgagggcagacgggtg
accgtgctggaggccgcggaccgggtcggcggcaagctgctgcccggcgagatcgcgggc
gtccgcgtggacctcggcgccgagtcgatgctcgcgcgccgccccgaggccgtcggtctg
gcccgcgaggtcggcctcgccgagcgcctccagccgccggccaccgccaccgcctccctg
tggacccgcggcgccctgcgccccatgcccaagggtcatgtcatgggcgtccccggcacc
gccgccgccctcgccggagtgctctccgacgagggcctcgcccgcatcgagcgggacacc
gaactgccccgcaccgaggtcggcgaggacgtggcggtcggggcgtacgtcgccgagcgg
ctgggccgggaggtcgtcgaccgtctcgtcgagccgctgctgggcggggtgtacgcgggc
gacgcctaccgcatctcgatgcgctcggccgtcccccagctcttccaggccgcacagacc
catgactccctgaccgaggcggtccgcgagatccaggccaaggccgccgcccaccagcag
cagtccggcccggtgttcatgggcatccagggcggcatcggcacccttccgctcgccgtc
gcggagtcggtgcgggcccggggcggcgagatcgtcaccggcgccccggtgaccgggctg
cgccgcgcgccggacggctggcggatcgtcaccggcggccggacactgcgcgcggacgcc
gtcgtcatcgccgtacccgcccccgtcgccgccggactgctgcgcgccgaggtccccgcc
gccgcggccgagctgaccgccgtcgagtacgcctccatggccctgatcaccctcgcctac
cgccgcgccgggaccgcgctccccgagggcagcggattcctggtgccgcccgtcgacggc
cacaccatcaaggcctccaccttcgcctcccggaagtggggctggatcgccgaggaggac
ccggacctgctggtgctgcgcacctccgtcggacgctacggcgagaccgagatcctccag
cgggacgacgccgccctcgtcgacgtctcccggcacgacctcaaggcggcgaccggcctc
gacgccaccccggtggccacccgcgtcacccgctggaccgagggtctgccccagtacccc
gtcggccaccacgcgcgcgtggcgcgcatccgcgagcacctcggccgcgtcccgggcctg
gccgtgtgcggtgccgcctacgacggggtcggcatcccggcgtgcatcgcgagcgcccat
gccgccgtcgaccagatccacggtgacctgcgcgcagtgcaggagctcaccgccaacccg
gtgcagagtctgcacggaggagcaggagaatga

DBGET integrated database retrieval system