KEGG   Streptomyces davawensis: BN159_2569Help
Entry
BN159_2569        CDS       T02518                                 

Definition
secreted alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sdv  Streptomyces davawensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sdv00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sdv00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sdv00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2908347..2910038)
Genome map
AA seq 563 aa AA seqDB search
MRSNIRRSKFSVTGSLALAAGLTAGLGTAPAAGAATPFAPLATPVAPLATPLMGWNSWNH
FGCNVTQQNIKDAADQIVAQGLDKLGYRYVNVDDCWMARTRDAGGHLQPDPVRFKDGIRA
LADYVHSKGLKFGIYQSAGTTTCAGLPGSLGHETTDANDFAAWGVDLLKYDNCPDGQGSI
EQRYKAMGDALKASGRAIVFSLCSWGQGSPWAGFGSVSGGSQWRTTYDIRDSWYDNKWTS
SPMGVIDILDQQKGLEVFSGPSKWNDMDMLEVGNGALRDDEYRSHFSLWALLNSPLILGN
DLTRMSDATKAIIKNADVIAVNQDWGGSQGRLMRDLGNGRQVWAKPMSDGSVAVVLLNRS
GAAAAITTSAAEIGLGGSSSYALKDLWTGTSSTSANGTISGQVPSHGVAMYRVSRTGTNA
AALPAGTHNIADLTWLASSTGWGTIRRNQSAEGNALTIGGTTYASGVGTHSDSAVHVWLG
GECRNFTAQVGVDNEVGANGTVRFQVYGDGKLLTHSDVMRGGQAASTLTASTQGVKQLEL
RVTDARDYIHFDHADWANARVSC
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcaaacatcagacgatcgaagttctcggtgaccggcagtcttgccctggcggcc
gggctgaccgccggtctcggcacggcacccgccgccggtgctgccaccccgttcgcgccc
ctggccaccccggtcgcgcccttggctactccgctcatgggctggaacagctggaaccat
ttcgggtgcaacgtcacgcagcagaacatcaaggacgctgccgatcagatcgttgcccag
gggctggacaagctcgggtacaggtacgtcaacgtggacgactgctggatggcccgcacc
cgagacgccggcggccaccttcagccggaccccgtcaggttcaaggacgggatcagggct
ctcgccgactatgtccacagcaagggcctgaagttcggcatctaccagtcggcgggcacc
acgacctgtgccggactgcccggaagcctcggtcacgagaccacggacgcgaacgacttc
gcggcctggggtgtggacctgctgaagtacgacaactgccccgacggccaaggctccatc
gagcagcgatacaaggcgatgggcgacgccctgaaggccagtgggcgggccatcgtgttc
agcctgtgcagttggggccaaggaagcccgtgggcgggattcggctcggtcagcgggggg
agccagtggcggaccacctacgacatccgcgactcctggtacgacaacaaatggacttcc
tcgcccatgggcgtcatcgacattctggaccagcagaagggtctggaggtgttttcgggg
ccaagcaagtggaacgacatggacatgctggaagtcggcaacggggcactccgcgacgac
gagtaccggtcgcacttcagcctgtgggcgctgctgaactcgccgttgatcctcggtaac
gatctcacccggatgtccgacgcgacaaaggcgatcatcaagaatgccgatgtcatcgcc
gtgaaccaggactggggcggctcgcagggcaggctcatgcgcgatttgggcaacggcagg
caggtatgggccaagcccatgtcggatggatccgtcgccgtggtgctgctcaaccgatcg
ggcgcggcggcggccatcacgacctcggccgcagagatcggcctcggcggttcttcctcc
tacgccctcaaggatctgtggaccggcacctcgtccacctcggccaacggcacgatcagc
ggccaggttccgtcgcacggggtggcgatgtaccgggtcagccgcaccggcaccaacgcc
gccgcgctgcccgccggcacacacaacatcgcggacctgacctggctggcgtcgtccacc
ggttggggaaccatccgcaggaaccagtccgccgaagggaacgccctcaccatcggcggc
accacctacgccagcggcgtcggaacccactccgattccgcggtccacgtctggctcggt
ggcgagtgccggaacttcaccgcgcaggtcggcgtggacaacgaggttggcgcgaacggc
accgtccggttccaggtctacggcgacggcaagctcctgacccacagcgacgtgatgagg
ggtggccaggcggcgagcaccctgaccgcgtccacgcaaggcgtcaagcagctcgaactg
cgggtcaccgacgcgcgggactacatccacttcgaccacgcggactgggcaaacgccaga
gtctcctgctga

DBGET integrated database retrieval system