KEGG   Streptomyces davawensis: BN159_2569Help
Entry
BN159_2569        CDS       T02518                                 

Definition
secreted alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sdv  Streptomyces davawensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BN159_2569
  Lipid metabolism
   00561 Glycerolipid metabolism
    BN159_2569
   00600 Sphingolipid metabolism
    BN159_2569
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BN159_2569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2908347..2910038)
Genome map
AA seq 563 aa AA seqDB search
MRSNIRRSKFSVTGSLALAAGLTAGLGTAPAAGAATPFAPLATPVAPLATPLMGWNSWNH
FGCNVTQQNIKDAADQIVAQGLDKLGYRYVNVDDCWMARTRDAGGHLQPDPVRFKDGIRA
LADYVHSKGLKFGIYQSAGTTTCAGLPGSLGHETTDANDFAAWGVDLLKYDNCPDGQGSI
EQRYKAMGDALKASGRAIVFSLCSWGQGSPWAGFGSVSGGSQWRTTYDIRDSWYDNKWTS
SPMGVIDILDQQKGLEVFSGPSKWNDMDMLEVGNGALRDDEYRSHFSLWALLNSPLILGN
DLTRMSDATKAIIKNADVIAVNQDWGGSQGRLMRDLGNGRQVWAKPMSDGSVAVVLLNRS
GAAAAITTSAAEIGLGGSSSYALKDLWTGTSSTSANGTISGQVPSHGVAMYRVSRTGTNA
AALPAGTHNIADLTWLASSTGWGTIRRNQSAEGNALTIGGTTYASGVGTHSDSAVHVWLG
GECRNFTAQVGVDNEVGANGTVRFQVYGDGKLLTHSDVMRGGQAASTLTASTQGVKQLEL
RVTDARDYIHFDHADWANARVSC
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcaaacatcagacgatcgaagttctcggtgaccggcagtcttgccctggcggcc
gggctgaccgccggtctcggcacggcacccgccgccggtgctgccaccccgttcgcgccc
ctggccaccccggtcgcgcccttggctactccgctcatgggctggaacagctggaaccat
ttcgggtgcaacgtcacgcagcagaacatcaaggacgctgccgatcagatcgttgcccag
gggctggacaagctcgggtacaggtacgtcaacgtggacgactgctggatggcccgcacc
cgagacgccggcggccaccttcagccggaccccgtcaggttcaaggacgggatcagggct
ctcgccgactatgtccacagcaagggcctgaagttcggcatctaccagtcggcgggcacc
acgacctgtgccggactgcccggaagcctcggtcacgagaccacggacgcgaacgacttc
gcggcctggggtgtggacctgctgaagtacgacaactgccccgacggccaaggctccatc
gagcagcgatacaaggcgatgggcgacgccctgaaggccagtgggcgggccatcgtgttc
agcctgtgcagttggggccaaggaagcccgtgggcgggattcggctcggtcagcgggggg
agccagtggcggaccacctacgacatccgcgactcctggtacgacaacaaatggacttcc
tcgcccatgggcgtcatcgacattctggaccagcagaagggtctggaggtgttttcgggg
ccaagcaagtggaacgacatggacatgctggaagtcggcaacggggcactccgcgacgac
gagtaccggtcgcacttcagcctgtgggcgctgctgaactcgccgttgatcctcggtaac
gatctcacccggatgtccgacgcgacaaaggcgatcatcaagaatgccgatgtcatcgcc
gtgaaccaggactggggcggctcgcagggcaggctcatgcgcgatttgggcaacggcagg
caggtatgggccaagcccatgtcggatggatccgtcgccgtggtgctgctcaaccgatcg
ggcgcggcggcggccatcacgacctcggccgcagagatcggcctcggcggttcttcctcc
tacgccctcaaggatctgtggaccggcacctcgtccacctcggccaacggcacgatcagc
ggccaggttccgtcgcacggggtggcgatgtaccgggtcagccgcaccggcaccaacgcc
gccgcgctgcccgccggcacacacaacatcgcggacctgacctggctggcgtcgtccacc
ggttggggaaccatccgcaggaaccagtccgccgaagggaacgccctcaccatcggcggc
accacctacgccagcggcgtcggaacccactccgattccgcggtccacgtctggctcggt
ggcgagtgccggaacttcaccgcgcaggtcggcgtggacaacgaggttggcgcgaacggc
accgtccggttccaggtctacggcgacggcaagctcctgacccacagcgacgtgatgagg
ggtggccaggcggcgagcaccctgaccgcgtccacgcaaggcgtcaagcagctcgaactg
cgggtcaccgacgcgcgggactacatccacttcgaccacgcggactgggcaaacgccaga
gtctcctgctga

DBGET integrated database retrieval system