KEGG   Streptomyces davawensis: BN159_2868Help
Entry
BN159_2868        CDS       T02518                                 

Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sdv  Streptomyces davawensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BN159_2868
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BN159_2868
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BN159_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3264094..3265959
Genome map
AA seq 621 aa AA seqDB search
MRGTPHTVRLLLAALLSTAGVTAATTPAQAAGEQVTAYLTTTDDSGGRHVTRGLQQQAPF
NFQSGTGGSGENITVDENTRYQTFTGGGASFTDTAAWLMDGSGALSQATRDETMRKLFSP
TEGIGLSFLRNPMGGSDLARFGYTYDDMPAGQTDPDLSEFSLAHDLQDVVPLTKQARQLN
PALTVMASPWTAPAWMKDSGQLNGGWLKAEHYGAYASYFVKYVQGYQAQGIPIAYVTAQN
EPTCCSGYPSMSWNASGLHYFTKNELLPKLQAAGLSTKVLAHDWNWSDYDAYAAQTVDDA
AIRSHPNFGGIAWHGYGGDVAKQTAVHNQYPQLDAFGTEHSGGTWIANQQREDMMNIIDY
TRNWAKSVTKWSLAVDQNRGPHNGGCGVCDGLITVHNGDSRHGQVDYMIEYYTMGHLTKF
VRPGAHRIASTASASVPNVAWRNPDGSKALIAYNDASTAKTVTINWGSQHSTYSLPGKTS
ATFTWSGNQSGGGEQSGAFVGLAGKCLDVAGGSSANGTAVQLYDCNGSAAQRWTVGADGS
VRALGKCLDVTGGSTANGAKVQLYDCNGTGAQQWSYNASTGDVVNRAADKCLDVTDNSSA
NGARAQIWSCTGAANQKWRLA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaggaaccccccacacggtccggctgctgctggccgcactgctctccacggccggc
gtcaccgcggcaaccacccctgcccaggcggcgggtgagcaggtcaccgcctatctcacg
accaccgacgacagcggcggccgccatgtcacccggggactccagcagcaggcaccgttc
aacttccagtccggcaccggcggttcgggcgagaacatcaccgtcgacgagaacacccgg
taccagaccttcaccggcggcggcgcctccttcaccgacaccgcggcctggctgatggac
ggcagcggtgcgctgtcccaggccacccgggacgagaccatgcgcaagctgttctccccg
acggagggcatcggtctgtcgttcctgcgcaatccgatgggcggctcggacctcgcgcgg
ttcggctacacctacgacgacatgccggccgggcagacggaccccgacctgtcggagttc
tccctcgcgcacgacctccaggacgtggtgccgctgaccaagcaggcgcggcagctgaac
ccggcgctcaccgtgatggcctcgccgtggaccgcgcccgcctggatgaaggacagcgga
cagctcaacggcggctggctgaaggcggagcactacggcgcctacgcctcctacttcgtg
aaatacgtgcagggctaccaggcccagggcatcccgatcgcgtacgtgacggcgcagaac
gagccgacgtgctgctcgggctatccgtcgatgagctggaacgcctccgggctgcactac
ttcaccaagaacgagctgctgcccaagctccaggcggccggcctgtcgacgaaggttctc
gcgcacgactggaactggtccgactacgacgcctacgcggcgcagaccgtggacgacgcg
gcgatccgctcgcaccccaacttcggcggcatcgcctggcacggctacggcggtgacgtg
gccaagcagaccgcggtgcacaaccagtacccgcagctggacgccttcgggaccgagcac
tcgggcggcacctggatcgccaaccagcagcgcgaggacatgatgaacatcatcgactac
acccgcaactgggcgaagtcggtgaccaagtggtccctcgccgtggaccagaaccggggt
ccgcacaacggcggttgcggggtctgcgacgggctgatcaccgtccacaacggggactcc
cggcacggccaggtggactacatgatcgagtactacacgatgggccacctcacgaagttc
gtccggcccggcgcccaccgcatcgcctccaccgcctcggcgtccgtgccgaacgtggcc
tggcgcaacccggacggctccaaggcgctgatcgcctacaacgacgcctccaccgcgaag
acggtgaccatcaactggggctcccagcactccacttactcgctgcccggcaagacctcg
gccaccttcacctggtccggcaaccagtccggcggcggcgagcagtcgggcgcgttcgtg
ggcctcgcgggcaagtgcctcgatgtggcgggcggttcgagcgccaacggcacggcggtg
cagctctacgactgcaacggatccgcggcccagcggtggaccgtgggcgccgacggctcg
gtgcgggcgctcggcaagtgcctcgacgtgacgggcggttcgacggcgaacggggcgaag
gtgcagttgtacgactgcaacggcaccggggcgcagcagtggtcgtacaacgcctcgacg
ggcgatgtggtgaaccgcgccgccgacaagtgcctcgatgtcaccgacaactcctcggcc
aacggcgcccgtgcgcagatctggagctgcacgggcgccgccaaccagaagtggaggctg
gcctga

DBGET integrated database retrieval system