KEGG   Streptomyces davawensis: BN159_2963Help
Entry
BN159_2963        CDS       T02518                                 

Gene name
glgB1
Definition
1,4-alpha-glucan-branching enzyme 1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sdv  Streptomyces davawensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sdv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3376084..3378600
Genome map
AA seq 838 aa AA seqDB search
MTPRPPSPGPDPQQSAERTAEEKSVVKKAAAKKTAAVTKKAVAKKAAAKKAAPKKKATAK
SATAAKAPAKKAAAKKATAKKATAKKAVSKKAVAKKAPAKKSPAERAVKALPVEVAVSPA
VDADDRARLIAGTHHAPHAVLGAHPVPGGIAFRAFRPYARSVTVLAGELRAGLHDDGGGF
FSGLLPLSEVPEYRILVTYDGAELETEDPYRFLPALGELDLHLIGEGRHEQLWKALGAEP
MTHQGVTGTRFTVWAPNARGVRLAGTFNFWDGSGFPMRSLGSSGVWELFVPAIGEGELYK
FEITRPDGSHTLRADPMARRTEAPPNTSSIVHASHHEWHDEEWLERRGRVPVHEAPFSVY
EVHLASWRPGLTYRQLAEQLPAYVKDLGFTHVELMPVAEHPFGGSWGYQVTGFYAPTARL
GTPDDFKFLVDALHRAGIGVLMDWVPAHFPRDDWALAEFDGRPLYEHEDPLRSAHPDWGT
LEFDFGRREVRNFLVANALYWCEEFHIDGLRVDAVASMLYLDYSREPGQWVPNVFGGREN
LDAVAFLQEMNATVYRRAPGVVTIAEESTAWDGVTRPTDSGGLGFGLKWNMGWMHDSLGY
LSHESIHRKYHHHEMTFSMVYAYSENYVLPISHDEVVHGKRSLVSKMPGDWWQQRANHRA
YLGFMWAHPGKQLLFMGQEFAQGAEWSEAHGPDWWLLDPAYGAEPDHRGVRDLVRDLNAL
YLDTPALWQRDTDPAGFRWVAGDAVEDNVFAFLRYAADGTPLLAVSNFSPVVRHDYRLGV
PDEVPAWHEALNTDAARYGGGDVTNPDPLKPEPQGRHGQATSIRLTLPPLATVWLRPA
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccccgccccccgtcccccggtccggatccacaacagtcggccgagcggacggcc
gaggagaagagcgtcgtgaagaaggcggcggcgaagaagaccgcggccgtgaccaagaag
gcggtcgccaagaaggccgccgcgaagaaggccgcgcccaagaagaaggccacggccaag
tcggccaccgccgcgaaggccccggccaagaaggccgccgcgaagaaagccaccgcgaag
aaggccaccgcgaagaaggcggtgtccaagaaggcggtggccaagaaggctcccgccaag
aagagccccgccgagcgggccgtgaaggcactgcccgtcgaggtcgccgtctcccccgcc
gtggacgcggacgaccgtgcccggctgatcgccggtacccatcacgcaccgcatgccgtg
ctcggcgcgcatcccgtgcccgggggaatcgccttccgggccttcaggccgtacgcccgt
tccgtgaccgtgctcgccggggagctgcgggccgggctgcacgacgacggcggggggttc
ttctcgggactgctgccgctgtcggaggtgccggagtaccggattctcgtgacgtacgac
ggtgcggagctggagaccgaggacccgtaccgcttcctgcccgcgctcggcgaactcgat
ctgcatctgatcggcgagggtcgccacgagcagctgtggaaggcgctgggcgccgagccc
atgacccatcagggggtgaccggcacccggttcacggtgtgggcgccgaacgcccgcggg
gtgcggctggccggcaccttcaacttctgggacggcagcgggttcccgatgcgctcgctg
ggctcgtccggggtgtgggagctgttcgttccggccataggggagggtgagctgtacaag
ttcgagatcacccggcccgacggttcgcacaccctgcgcgccgacccgatggcccgccgc
accgaggccccgccgaacacctcgtcgatcgtgcacgcctcgcaccacgagtggcacgac
gaggagtggctggagcggcgcggtcgggtgccggtgcacgaggcgcccttctcggtgtac
gaggtccatctggcgtcctggcgcccgggtttgacgtaccgccagctcgccgaacagctc
ccggcgtacgtcaaggacctgggcttcacccacgtggagctgatgccggtcgccgagcat
cccttcggcggttcctggggctatcaggtcaccggcttctacgcgccgacggcccgcctc
ggtacgcccgacgacttcaagttcctggtcgacgccctgcaccgggcgggcatcggcgtg
ctaatggactgggtcccggcgcatttcccgcgcgacgactgggcattggcggagttcgac
gggcgtccgctctacgagcacgaggacccgttgcgctcggcgcatcccgactggggcacg
ctggagttcgacttcgggcgccgcgaggtgcgcaacttcctggtggcgaacgccctttac
tggtgcgaggagttccacatcgacgggctgcgggtggacgcggtcgcctcgatgctctac
ctcgactactcccgtgagccggggcagtgggtgccgaatgtgttcggcgggcgggagaac
ctggacgcggtggcgttcctccaggagatgaacgccacggtgtaccggcgggcgccgggt
gtggtgacgatcgcggaggagtccaccgcctgggacggggtgacccggcccaccgacagc
ggcgggctcggcttcggcctgaagtggaacatgggctggatgcacgactcgctgggctac
ctgtcgcacgagtcgatccaccgcaagtaccaccaccacgagatgacgttctcgatggtg
tacgcgtacagcgagaactacgtgctgccgatctcgcacgacgaagtcgtccacggcaag
cggtcgttggtgtcgaagatgccgggcgactggtggcagcagcgcgcgaaccatcgggcg
tatctgggcttcatgtgggcccaccccggcaagcaactcctcttcatgggacaggagttc
gcgcagggcgccgagtggtcggaggcgcacggtccggactggtggctgctggatccggcg
tacggcgcggagccggaccaccgaggcgtgcgcgatctggtccgggacctgaacgcgctc
tatctggacaccccggcgctgtggcagcgggacaccgacccggccggtttccggtgggtg
gccggggacgcggtggaggacaacgtcttcgcgttcctcaggtacgccgccgacggcact
cccctgctggccgtctccaacttctcgccggtggtacggcacgactaccgcctcggcgtc
ccggacgaggtcccggcctggcacgaagcgctcaacaccgacgcggcacgctacggcggc
ggcgacgtcaccaaccccgaccccctgaagccggaaccccagggccggcacggccaggcg
acgagcatccgcctgaccctgccccccttggcgacggtgtggctccgccccgcctag

DBGET integrated database retrieval system