KEGG   Streptomyces davaonensis: BN159_3064Help
Entry
BN159_3064        CDS       T02518                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00220  Arginine biosynthesis
sdv00330  Arginine and proline metabolism
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
sdv01130  Biosynthesis of antibiotics
sdv01230  Biosynthesis of amino acids
Module
sdv_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BN159_3064
   00330 Arginine and proline metabolism
    BN159_3064
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BN159_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CCK27443
UniProt: K4R281
Position
complement(3485627..3486526)
Genome map
AA seq 299 aa AA seqDB search
MQNPPNPQSLAIIEAPSVLGLRPGGVSDLPRALRGAGLLDGFRVASEERLDPPEYDEARD
PDTAVLNPTAIARYSLTLADAVESALDQDLFPLVLGGDCTILLGNLLALRRRGRPGLLFL
DGHTDFYQPSAEPRGEAASMELALATGRGPATLTDLEGRAPLVRDEDVVAFAFRDEAESS
RAGMQPLPEAMHTLNLSTIRELGIEAATHQALTALPAAYWTHLDADVLHDNVMPAVDYRQ
PDGLTWPELDHVLTAALTDDRCRGLDVTIFNPHLDPTGTITTRFTECLRGALSARAITQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatccgccgaacccgcagagcttggcgatcatcgaggcaccgtcggtactcggc
ctacggccgggcggcgtgtcggacctgccgagggcactgcgcggagcgggcctgctggac
ggcttcagggtggcgagcgaagagaggctggaccctccggaatacgacgaggcacgcgac
ccggatacggccgtactcaacccgacagccatcgcgcgctactcactcaccctcgcggac
gccgtggaatccgccctggaccaggacctcttcccgctcgtcctcggcggggactgcacc
atcctgctgggcaacctcctcgccctgcgccgccgaggccgccccggactcctgttcctg
gacggccacaccgacttctaccagccgtcagccgagccgaggggcgaggcagcctcgatg
gaactggccctcgccacgggcagaggccccgccaccctcacggacctggaaggccgcgcc
ccgttggtgcgggacgaggacgtggtggctttcgcgttccgggacgaggcggaatcctcc
cgggcaggcatgcagcccctgcccgaggccatgcacacactgaacctgtcgacaatccgc
gaactgggcatcgaagcggcaacgcaccaggccctaaccgccctccccgccgcctactgg
acccacctggacgccgacgtcctgcacgacaacgtcatgccggccgtcgactaccgccaa
cccgacggcctgacctggccggagctcgaccacgtactgaccgcggccctcaccgacgac
cgctgccggggcctggacgtcacgatcttcaacccccacctggaccccacaggcacgatc
accacccgcttcacggagtgcctccgaggggctctctcggcgagggcgatcacacagtga

DBGET integrated database retrieval system