KEGG   Streptomyces davaonensis: BN159_3411Help
Entry
BN159_3411        CDS       T02518                                 

Gene name
aspC1
Definition
(GenBank) putative aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00220  Arginine biosynthesis
sdv00250  Alanine, aspartate and glutamate metabolism
sdv00290  Valine, leucine and isoleucine biosynthesis
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
sdv01130  Biosynthesis of antibiotics
sdv01210  2-Oxocarboxylic acid metabolism
sdv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN159_3411 (aspC1)
   00290 Valine, leucine and isoleucine biosynthesis
    BN159_3411 (aspC1)
   00220 Arginine biosynthesis
    BN159_3411 (aspC1)
Enzymes [BR:sdv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BN159_3411 (aspC1)
    2.6.1.66  valine---pyruvate transaminase
     BN159_3411 (aspC1)
Amino acid related enzymes [BR:sdv01007]
 Aminotransferase (transaminase)
  Class I
   BN159_3411 (aspC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CCK27790
UniProt: K4R3X1
Position
3856103..3857365
Genome map
AA seq 420 aa AA seqDB search
MVGNTAQAALPGRKLTDMQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPA
AFGFECPPEILEDILRNVSSAHGYGDAKGLLAARRAVVMHNQTLGIETDVEHVFIGNGAS
ELIVMAMQGLLDDGDEVLIPSPDYPLWTAAVSLSGGTAVHYRCDEQSDWMPDLADVERKI
TDRTKALVIINPNNPTGAVYDEAMIKGLTDIARRHNLLVCSDEIYDKILYDGATHTATAK
IAPDLLTLTFNGMSKAYRVAGYRVGWMSISGPRAHADSYIEGLTILANMRLCANMPGQHG
VVAALSGRQTINDLVLPGGRLKEQMDVAYELLTQIPGVSCVRPKGALYLFPRLDPKVYKI
KDDRQLVLDLLRREKIMVVQGTGFNWSEPDHFRVVTLPNVGDLRDAVTRIGNFLDGYSQL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggtgggaaacacggcccaagcggcgttaccgggccgtaagctcaccgacatgcaggtg
atccagtcgaccaagctcgccaacgtctgttacgagatccggggtccggttctcgaggag
gccatgcggcttgaggcggcgggccaccgcatcctcaagctgaacaccggcaatccggcc
gccttcgggttcgagtgcccgccggagatcctggaggacatcctccgcaacgtgtcgtcg
gcccacgggtacggcgacgccaagggcctgctcgccgcccgccgcgccgtcgtgatgcac
aaccagaccctcggcatcgagaccgacgtcgagcacgtcttcatcggcaacggcgcctcc
gagctgatcgtgatggcgatgcaggggctgctggacgacggggacgaggtgctgatcccc
tcgccggactacccgctgtggacggccgcggtgtcgctgtccggcggcacggcggtgcac
taccgctgcgacgagcagtccgactggatgccggacctcgccgacgtggagcggaagatc
accgaccgcaccaaggcgctcgtgatcatcaacccgaacaaccccacgggcgccgtctac
gacgaggcgatgatcaaggggctcaccgacatcgcgcgccggcacaatctgctggtctgc
tccgacgagatctacgacaagatcctctacgacggggccacgcacaccgcgaccgccaag
atcgcccccgatctgctgacgctcaccttcaacggcatgtccaaggcgtaccgggtcgcc
gggtaccgcgtcggctggatgtcgatctccgggccgcgcgcccacgccgactcctacatc
gagggtctgacgatcctcgccaacatgcggctgtgcgccaacatgcccggtcagcacggt
gtcgtcgccgcgctgagcggccggcagaccatcaatgacctggtgctgcccggcgggcgg
ctgaaggagcagatggacgtcgcctacgagctgctcacccagatccccggggtgagctgt
gtacggcccaagggcgccctctatctcttcccccgcctcgaccccaaggtctacaagatc
aaggacgaccggcagctcgtcctggacctgctgcggcgcgagaagatcatggtcgtccag
gggaccgggttcaactggagcgaacccgaccacttccgggtcgtgaccctgccgaacgtc
ggcgacctccgggacgcggtgacccggatcgggaacttcctcgacggctacagccagctc
tga

DBGET integrated database retrieval system