KEGG   Streptomyces davaonensis: BN159_3636Help
Entry
BN159_3636        CDS       T02518                                 

Gene name
choD
Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00984  Steroid degradation
sdv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BN159_3636 (choD)
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BN159_3636 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Fer4_9 Pyr_redox Fer4_10 HI0933_like Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: CCK28015
UniProt: K4R4L9
Position
complement(4101645..4103438)
Genome map
AA seq 597 aa AA seqDB search
MSNDADDNDAYDYDVLVVGSGFGGSVTALRLTEKGYKVGVLEAGRRFTRESLPKNSWDLK
NFLWAPKLGMFGIQRIHLLGNVMVLAGAGVGGGSLNYANTLYVPPKPFFDDPQWRDITDW
QEELKPYYDQAQRMLGVRLNPTMTPSDVHLKDAAQKMGVGDSFHMAPVGVFFGDGEDADG
ATKAKPGQQVDDPYFGGAGPARKACTECGECMTGCRHGAKNTLNENYLYLAEKAGAVVHP
MTTVVSVTDDSRGGYAVTTLPTDRKKKGESRVFKARRVVLAAGTYGTQTLLHRMKASGRL
PYLSPKLGELTRTNSEALVGAQTDDRRYRKATGEKKVDFTRGVAITSSVHPDTNTHIEPV
RYGKGSNSMGSLTILQVPYTEGASRLAAWLGNAARHPLLIMRSLSNRRWSEKTIIGLVMQ
SLDNSLTTYLKPDGVGKGMLTARQGHGSPNPMQIKAATEGASALAESINGFPGSNVGELM
GTPLTAHFLGGCPIGASRESGVIDPYHRLYGHPGISVVDGAAVSANLGVNPSLTITAQAE
RAMSYWPNKGEEDPRPAQDQPYERLQAVEPKQPAVPAEAFGALRLPFLGMPTVPPKK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgacgctgacgacaacgacgcctacgactacgacgtcctcgtcgtcggatcc
ggcttcggcggttcggtgaccgcactgcggctgaccgagaagggctacaaggtaggcgtc
ctggaagcgggccgccgcttcacccgggagtccctgcccaagaactcctgggacctgaag
aacttcctctgggccccgaagctcggcatgttcggcatccagcgcatccatctgctgggc
aacgtcatggtgctggcgggcgccggcgtgggcggcggatcgctgaactacgccaacacc
ctctacgtaccgccgaagccgttcttcgacgacccgcagtggcgtgacatcaccgactgg
caggaggagttgaagccgtactacgaccaggcccagcggatgctcggcgtgcggctcaac
ccgacgatgaccccgtccgacgtccatctgaaggacgccgcgcagaagatgggcgtcggg
gactccttccacatggcgccggtcggggtgttcttcggcgacggcgaggacgccgacggc
gcgacgaaggcgaagcccggccagcaggtggacgacccctatttcggtggcgcgggcccg
gcccgcaaggcctgcaccgagtgcggcgagtgcatgacgggctgccgccacggagcgaag
aacaccctcaacgagaactacctctacctcgccgagaaggccggcgcggtcgtccacccc
atgaccacggtcgtgtcggtcaccgacgactcgcggggcggctacgccgtcacgaccctt
ccgacggaccgcaagaagaagggcgagagccgcgtcttcaaggcccgccgcgtcgtcctc
gccgcgggcacctacggcacccagaccctgctgcaccgcatgaaggccagcgggcggctg
ccgtatctctcgccgaagctgggcgagctgacccgcaccaactccgaggcgctggtgggc
gcgcagaccgacgaccggcgctaccgcaaggcgaccggcgagaagaaggtcgacttcacg
cgtggcgtcgccatcacctcgtccgtccacccggacaccaacacccatatcgagcctgtc
cgttacggcaagggctccaactccatgggcagcctgacgatccttcaggtgccgtacacg
gagggcgcctcgcgcctcgcggcctggctcggcaacgccgcccggcatccgctgctgatc
atgcgctcgctgtccaaccgccgctggtcggagaagaccatcatcggcctggtgatgcag
tccctggacaactccctgacgacgtacctgaagccggacggcgtcggcaagggcatgctc
accgcccgccagggccatggctcgcccaacccgatgcagatcaaggcggccaccgagggc
gcgtccgcgctcgcggagtcgatcaacggcttcccgggctccaacgtcggcgagctgatg
ggtaccccgctcaccgcgcacttcctcggcggctgcccgatcggcgcctcccgggagtcc
ggcgtgatcgacccgtaccaccggctgtacggccacccgggcatctcggtggtcgacggt
gccgcggtctccgcgaacctgggcgtgaacccctcgctgaccatcaccgcgcaggccgag
cgggcgatgtcgtactggcccaacaagggcgaggaggacccgcgtccggcgcaggaccag
ccgtacgaacgactccaggcggtcgagccgaagcagcccgcggtcccggcggaggcgttc
ggcgcgctgcggctgccgttcctggggatgcctacggtgcccccgaagaagtag

DBGET integrated database retrieval system