KEGG   Streptomyces davawensis: BN159_3977Help
Entry
BN159_3977        CDS       T02518                                 

Definition
uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
sdv  Streptomyces davawensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sdv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4445788..4447488)
Genome map
AA seq 566 aa AA seqDB search
MSPTTLPAGLEHGHVTFLGAGPGDPGLLTLRAVEALANADVLVAEHEVLDVVRVHARTGV
AVVNTDPSAEPGPGTGTPQLAVVDGASTTAGAPAVRDAAHLVMEAARGGRRVVRAVSGDP
GLDTYAAEEMLACAAAGVPFEVVPGVAAAVGVPAYAGVPLRDAHGADVRFVDARTASDRC
WTEVGASDGTVVVTTTLDSVGAAAGELVAAGRKPDTPMTVTVAGTTTRQRTWTATLGTIA
QTLKQAKVLPSPEGGRPVIAVVGERSAAAQREQLSWFESKPLFGWRVLVPRTKEQAASLS
DQLRSYGAVPHEVPTIAVEPPRTPQQMERAVKGLVTGRYEWIAFTSVNAVKAVREKFEEY
GLDARAFAGIKVAAVGEQTAKALIAFGVKPDLVPSGEQSAAGLLEDWPPYDPVFDPIDRV
FLPRADIATETLVAGLIELGWEVDDVTAYRTVRASPPPAETREAIKGGGFDAVLFTSSST
VRNLVGIAGKPHNVTVIACIGPATAKTAEEHGLRVDVMAPEPSVHKLAEALADFGAKRRD
AAVEAGDPVTRPSERRPGARRRRSTT
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
gtgagccccaccacccttcccgccggccttgaacacgggcacgtcaccttcctgggtgcc
ggacccggggatccgggactgctgactctgcgcgccgttgaggcgctggcgaacgcggat
gttctcgtcgccgagcacgaggtgctcgacgtcgtccgcgtccacgccaggacaggcgtc
gccgtcgtgaacacggatccctctgcggagccgggtccgggcacaggcacgcctcagctg
gcggttgttgacggcgcgtcaacaaccgctggtgcacccgctgtgcgggatgcggcacat
cttgtcatggaggccgcgcggggcggcaggcgggtcgtgcgtgcggtgtccggggacccc
gggctcgacacgtacgccgccgaggagatgctggcgtgcgccgcggccggggtgcctttc
gaggtggtccccggtgtcgcggccgcggtcggtgtgcccgcgtacgccggtgtgccgctg
cgcgacgcgcacggcgcggatgtgcggttcgtggacgcgcggacggcgtcggaccggtgc
tggacggaggtcggtgcctcggacgggacggtcgtcgtcacgacgacgctcgactccgtg
ggcgctgcggccggtgagctggtggccgccggtcgtaagccggacaccccgatgacggtc
accgtcgccggtacgaccacgcgtcagcggacctggaccgcgacgctcggcaccatcgcg
cagacgctgaagcaggccaaggtgctgccctcgccggaaggcgggcggccggtgatagcc
gtggtcggtgagcggtccgcggcggctcagcgtgagcagctgtcgtggttcgagtccaag
ccgctcttcgggtggcgggtgctggtgccgcgcaccaaggagcaggcggcttcgctctcc
gaccagcttcggtcgtacggggcggttccgcacgaggtgccgacgatcgccgtcgagccg
ccgcggacgccgcagcagatggagcgcgcggtcaagggcctggtgaccggccgctacgaa
tggatcgccttcacctcggtgaacgcggtcaaggcggtgcgcgagaagttcgaggagtac
gggctcgacgcgcgggcgttcgccggtatcaaggtcgccgcggtgggcgagcagacggcg
aaggcgctgatcgcgttcggtgtgaagccggatctcgtgccgtcgggcgagcagtcggcc
gcgggtctgctggaggactggccgccgtacgaccccgtcttcgacccgatcgaccgggtg
ttcctgccgcgggcggacatcgccacggagacgctggtcgccgggctgatcgagctcggg
tgggaggtggacgacgtcacggcctaccggaccgtgcgggcgtcgccgccgccggcggag
acgcgggaggcgatcaagggcggtggcttcgacgcggtcctcttcacctcgtcgtcgacc
gtccggaacctggtgggtatcgccggtaagccgcacaacgtgacggtgatcgcctgtatc
ggtcccgccacggcgaagaccgccgaggaacacgggctgcgggtcgatgtgatggctccg
gagccgtccgtgcacaagctggctgaggcgctggccgacttcggcgcgaagcggcgggac
gcggcggtggaggccggggatccggtcactcggccgagtgagcgtcggccgggggcgcgg
aggcgtcgttcgacgacgtga

DBGET integrated database retrieval system