KEGG   Streptomyces davaonensis: BN159_4057Help
Entry
BN159_4057        CDS       T02518                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00790  Folate biosynthesis
sdv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN159_4057 (folE)
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BN159_4057 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: CCK28436
UniProt: K4QWJ0
Position
complement(4538160..4538765)
Genome map
AA seq 201 aa AA seqDB search
MTDPVTLDGEGRIGEFDEKRAENAVRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLW
QQPEDVLTTTFDLGHDEMVLVKDIEVYSTCEHHLVPFRGVAHVGYIPATTGKITGLSKLA
RLVDVYARRPQVQERLTTQIADSLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSA
VRGQLRDAATRAEAMSLIMAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccccgtgacgctggacggcgagggccgcatcggcgagttcgacgagaagcgc
gccgagaacgccgtacgcgaactgctgatcgcggtcggagaggacccggatcgcgagggc
ttgagggagacgccggggcgggtcgctcgggcgtacaaggagatattcgcggggctgtgg
cagcagcccgaggacgtgctgaccacgacgttcgacctcgggcacgacgagatggtgctc
gtgaaggacatcgaggtgtactcgacctgtgagcatcatctggtcccgttccggggcgtg
gcgcacgtcggctacattccggccaccaccggcaagatcacggggctgtccaagctggcc
cggctcgtcgatgtctacgcccgccgcccgcaggtgcaggaacgactcaccacgcagatc
gcggactccctgatggagatccttgagccgcgcggcgtcatcgtggtcgtggagtgcgag
cacatgtgcatgtcgatgcgggggatccgcaagccgggggcgaagactcttacctcggcg
gtgcgcggtcaactgcgcgatgcggcgacccgggccgaggcgatgagcctgatcatggcg
cgctga

DBGET integrated database retrieval system