KEGG   Streptomyces davawensis: BN159_4099Help
Entry
BN159_4099        CDS       T02518                                 

Gene name
pphA
Definition
Phosphonopyruvate hydrolase (EC:3.11.1.3)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
sdv  Streptomyces davawensis
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:sdv00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4585919..4586854
Genome map
AA seq 311 aa AA seqDB search
MTGSRPPQQEPNDPPTGAAQRLRSALAAPRLTRAMGSHSPLSARLAEEAGFDVVWSSGLE
ISATAGVPDANILALGECLDAAAGLAAAVDIPVLADCDSGFGNVNNVIHMVRSYEARGVA
GVCIEDKQFPKLNSFIEGNQDLAPLDDFAGKIRAATETRTDMVVVARLEALISGQGMAEA
LRRADVYERAGADALLIHSKRKDPEEVFAFREAYHGGLPVIVVPTTYNQVTVEELEQRGF
AMAIYANQALRSSIRAMRETLTKIMRDGTTLNVEPELAPLKEIFDLQRMPQMLQQQERYE
SLGRELAEAAQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggagccgaccgccccagcaggaaccgaacgacccgccgaccggcgcggcacag
cggctgcgctcggcgctcgccgcaccgcgactgacacgtgccatgggctcgcacagcccg
ctcagcgcacggctcgccgaggaggccggcttcgacgtcgtctggtccagcgggctggag
atctcggccacggccggcgtgcccgacgccaacatcctcgccctgggcgaatgcctcgac
gcggccgccggcctcgcggccgccgtggacatcccggtcctcgcggactgcgactccggg
ttcggcaacgtcaacaacgtcatccacatggtgcgctcctacgaggcgcgcggcgtggcc
ggcgtgtgcatcgaggacaagcagttccccaagctcaacagcttcatcgagggcaaccag
gacctcgccccgctggacgacttcgcgggcaagatccgggccgccacggagacgcgtacc
gacatggtcgtggtcgcccggctggaggcgctgatctccgggcagggcatggcggaggca
ctgcgccgggccgacgtgtacgagcgggccggggcggacgccctgctcatccactccaag
cgcaaggaccccgaggaggtcttcgccttccgcgaggcctaccacggcggactcccggtg
atcgtcgtgccgaccacgtacaaccaggtcaccgtcgaggaactggagcagcgcggcttc
gccatggcgatctacgccaaccaggcgctgcgcagctcgatccgggccatgcgggagacc
ctcaccaagatcatgcgggacggcaccacgctgaacgtggagcccgaactcgccccgctc
aaggagatcttcgacctgcagcgcatgccccagatgcttcagcagcaggagcgctacgag
tccctgggacgcgaactcgcggaggccgcacagtga

DBGET integrated database retrieval system