KEGG   Streptomyces davawensis: BN159_5145Help
Entry
BN159_5145        CDS       T02518                                 

Definition
(RefSeq) fatty acid desaturase (membrane)
  KO
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sdv  Streptomyces davawensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BN159_5145
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BN159_5145
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BN159_5145
Lipid biosynthesis proteins [BR:sdv01004]
 Desaturase
  First
   BN159_5145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5717257..5718267)
Genome map
AA seq 336 aa AA seqDB search
MTTSSDVIEDAPQANDDTTTTSATLGGEQKRSIEQIALLLFIAVPFVALLAAVPLAWGWG
VSWLDLGLLVFFYYLGCHGITIGFHRHFTHGSFKAKRPLKIALAIAGSMAVEGPLVRWVA
DHRKHHKFSDAEGDPHSPWKYGETLPALMKGLWWAHIGWMFDEEQTSQEKYAPDLVKDPV
LRAISRQFIYWTMLSLALPALIGGLVTWSWWGAFTGFFWGSLVRVALLHHVTWSINSICH
AVGKRPFKSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVMRGQIDSSARLIRWFEL
AGWAYDVRWPSRSRIDSRRNTEEDRSRRGAKAANAA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgagctccgatgtgatcgaagacgccccgcaggcgaacgacgacaccacgacc
acctccgccacgctcggcggcgagcagaagcgctcgatcgaacagatcgcgctgctgctc
ttcattgccgtcccgttcgtggcgctgctggcggcggtgccgctggcctggggctgggga
gtgagctggctcgacctcggcctgctggtcttcttctactacctgggctgccacggcatc
acgatcggtttccaccgtcacttcacccacggttccttcaaggcgaagcgccctctgaag
atcgcgctggcgatcgccgggtcgatggcggtcgagggccccctggtccgctgggtcgcc
gaccaccgcaagcaccacaagttctccgacgccgagggcgacccgcactcgccgtggaag
tacggcgagaccctgcccgcgctgatgaagggcctgtggtgggcccatatcggctggatg
ttcgacgaggagcagacctcgcaggagaagtacgccccggatctggtcaaggacccggtg
ctccgggcgatctcccggcagttcatctactggacgatgctgtcgctggcgctgcccgcg
ctgatcggcggcctggtgacctggtcctggtggggcgcgttcaccggcttcttctggggc
tccctcgtccgggtggccctgctgcaccacgtgacctggtcgatcaactccatctgccac
gcggtcggcaagcgtcccttcaagtcgcgggaccggtcgggcaacgtgtggtggctggcg
gtgctgtcctgcggcgagtcctggcacaacctgcaccacgccgacccgacctcggcgcgg
cacggtgtgatgcgcgggcagatcgattcgagcgcccgtctgatccgctggttcgagctg
gcgggctgggcgtacgacgtgcgctggccgtcacgctcgcgtatcgattcccgccgtaac
accgaggaagaccgctcccggcgcggggccaaggccgcgaacgcggcatga

DBGET integrated database retrieval system