KEGG   Streptomyces davaonensis: BN159_5330Help
Entry
BN159_5330        CDS       T02518                                 

Definition
(GenBank) bifunctional uroporphyrinogen-III synthetase/response regulator domain protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00860  Porphyrin and chlorophyll metabolism
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
sdv01120  Microbial metabolism in diverse environments
Module
sdv_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN159_5330
Enzymes [BR:sdv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN159_5330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CCK29709
UniProt: K4RAF2
Position
5948053..5949210
Genome map
AA seq 385 aa AA seqDB search
MYEQHKPDQGQHGPLAGFTVGVTAARRADELGALLQRRGAAVLHAPALRIVPLADDGELL
AATKEIVDQVPDVVVATTAIGFRGWIEAADGWGFGEDLLDRLRGVELLARGPKVKGAIRA
AGLTEEWSPSSESMAEVLDRLLEEGVEGRRVVVQLHGEPLPGFVEALRAGGAEVVGVPVY
RWMPPEDLSPVDRLLDATVSRGLDALTFTSAPAAASLLSRAEQRGLLPELLEALNHDVVP
ACVGPVTALPLQSRGIDTVQPDRFRLGPLVQLLCQELPGRARSLPVAGHRVEIRGHAVLV
DGELRPVPPAGMSLLRALSRRPGWVVARADLLRALPGAGRDEHAVETAMARLRSALGTPK
LIQTVVKRGYRLALDPAADAKYADG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaacagcacaagcccgaccaagggcaacacggccctctcgcggggttcaccgta
ggggtgaccgccgcgcgccgcgccgacgaactgggggcgctgcttcagcggcgcggcgcc
gccgtcctgcacgcacctgccctgcgcatcgtgccgctggccgatgacggtgaactgctc
gcggccaccaaggagatcgtggaccaggtgccggacgtggtggtcgcgacgaccgcgatc
ggcttccggggctggatcgaggccgccgacggatggggcttcggggaggacctgctggac
cggttgcgcggggtggagttgctcgcccgcgggccgaaggtgaagggggcgatccgggcc
gccgggctgaccgaggaatggtcgccgtcgtccgagtcgatggcggaggtgctggaccgg
ctgctggaggagggcgtcgagggccgccgggtcgtcgtccagctgcacggtgagccgctg
cccgggttcgtggaggcgctgcgggccgggggagcggaggtggtgggggtgccggtgtac
cggtggatgccgccggaggacctcagtccggtggaccggttgctggacgcgacggtctcc
cgcggcctcgacgcgctgaccttcaccagcgcaccggcggcggcgtcgctgctgtcgcgg
gcggagcagcgggggctgctgccggaactcctggaggctctgaaccacgacgtcgtcccg
gcctgcgtcggtccggtcaccgcgctgcccttgcagtcccggggcatcgacacggtccag
cccgaccgcttccggctcggccccctggtccagctcctgtgccaggaactgcccgggcgc
gcccggtcgttgccggtggcggggcatcgggtggagatccgggggcatgcggtgctggtg
gacggggagttgcgcccggtgccaccggccgggatgtccctgctgcgggcgctgtcccgg
cgtccggggtgggtggtggcgcgggccgatctgctgcgggcgctgccgggtgcgggccgt
gacgagcacgcggtggagacggccatggcccgtctgcgctcggcccttggcacccccaag
ctgatccagacggtggtgaagcgggggtatcggctggcgctggatccggcggcggatgcg
aagtacgcggacgggtag

DBGET integrated database retrieval system