KEGG   Streptomyces davawensis: BN159_5433Help
Entry
BN159_5433        CDS       T02518                                 

Definition
secreted endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sdv  Streptomyces davawensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sdv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6050997..6052013
Genome map
AA seq 338 aa AA seqDB search
MYGSRGARRGATATVLGAALLIAGCSSSDDGGDEPENAAGITQQPKEVDPFWVNPDGNAA
QQVATYAKDGKDDDAEQIRKIAEQPTGEWIGPENPEDEARGFTEAADKAGRTALLVLYNI
PHRDCGQYSQGGAADGNAYREWIDGVAAGIGDRSTTVILEPDAVLHLVDGCTPDEFHEER
YDLLKGAIEKLKSLKNTKVYLDAGNAGWGNPDQIFEPLKWAGVEGADGFSVNVSNFYTTE
NSIEYGKTLSSKIGNKPFVIDTSRNGNGPYEEGDAGERWCNPPGRALGETPTTKTADDLV
DAYIWVKRPGESDGECKGGPKAGEWWPEYALGLAKASQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcagcaggggggcccgaaggggagccaccgcgacggtgctgggggcggcactg
ctgatcgcggggtgttcctcctcggacgacgggggtgacgagccggagaacgcggccggc
atcacccagcagcccaaggaagtcgacccgttctgggtgaacccggacggcaacgcggcc
cagcaggtggccacctacgcgaaagacggcaaggacgacgacgcggaacagatccgcaag
atcgccgagcagccgaccggtgagtggatcggcccggagaacccggaggacgaggcgcgc
ggcttcaccgaggccgcggacaaggcgggccgtacggcgctgctggtcctctacaacatc
ccgcaccgtgactgcggtcagtactcacagggcggcgccgccgacggcaacgcctaccgt
gagtggatcgacggcgtggcggcgggcatcggtgaccgctcgacgacggtcatcctcgaa
ccggacgccgtgctgcacctggtggacggctgcaccccggacgagttccacgaggagcgc
tacgacctcctcaagggcgccatcgagaagctcaagtccctgaagaacaccaaggtgtac
ctggacgcgggcaacgccggctgggggaaccccgaccagatcttcgagccgctgaaatgg
gcgggcgtcgagggcgcggacggcttctcggtgaacgtctcgaacttctacaccaccgag
aactccatcgagtacggcaagaccctctcgtcgaagatcggcaacaagcccttcgtcatc
gacaccagccgcaacggcaacggcccgtacgaggagggcgacgcgggggagcgctggtgc
aacccgccgggcagggccctgggcgagaccccgacgacaaagacggcggacgacctggtc
gacgcctacatctgggtcaagcgcccaggagagtcggacggcgagtgcaagggcggcccg
aaggccggggagtggtggccggagtacgcgctcggcctggccaaggcttctcagtga

DBGET integrated database retrieval system