KEGG   Streptomyces davawensis: BN159_5631Help
Entry
BN159_5631        CDS       T02518                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sdv  Streptomyces davawensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sdv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6273570..6275699
Genome map
AA seq 709 aa AA seqDB search
MAAQRSAASPSEDVPSASSSEDVPSEDLSRLAELHGVATSYRPSPDRTVRASVTALTSAL
AALDIDVTTPEAVRRALAAREREVRERLLPPTVVCWEGPDSGPPAALTALPPGTRLRVET
EQGETRAAADRLPPGVHRLTATAPDGRSATAHLVVAPARLPAPAGRSHGLLVQLYSLLSR
RSWGMGDLGDLAELAGWAGRTLGTGFVQVNPLHAAVPGAPTDPSPYRPSSRRFPDPVHLR
VEDIPEYGRVEDRERVRALLERARLLRESVLEKGALIDRDGVWDLKREALELVREVPLGP
GRRAAYADFLAAEGQALEDHATWCALAEVHGSDWRRWPEPLRDPRSAETARARGELMDRV
DFHSLLAWLTDAQLTAAQRVAREAGMAVGIVHDLAVGVHPDGADAWAQQEYFAAGMSVGA
PPDAFNARGQDWGLPPWRPDRLAESGYTPYRRLLKALFRYAGALRIDHVMGLFRLWWVPQ
GQPPTDGTYVRYDAEAMLAILVLEASRAGALVIGEDLGTVEPGVREALRARGVLGTSVLW
FERDWEGDGRPLPPEQWRSDCLATATTHDLPSTAARLTGEHVELRHSLGLLTRSLAEERA
EAAADTGEWLAVLSRLGLLHGTGGGHGTSQEEAEIQAVHRFLLRTPARMVGVWLPDTVGD
RRPQNLPGTWDQFPNWRLPIADAEGKPVTLEELAASPRLHALLELMRPA
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagcggtcggccgcatccccgtccgaggacgttccctccgcatcctcgtcc
gaagacgttccctccgaggatctgtcgcggctcgccgaactgcacggcgtcgccacctcc
taccggccctccccggaccgcacggtccgcgcctcggtcaccgcgctcacctcggcgctg
gccgcgctcgacatcgacgtgaccacccccgaagccgtacgacgtgccctcgccgcgcgc
gaacgcgaggtgcgggagcggctgctgccgccgacggtggtgtgctgggaggggccggac
tcggggccgcccgccgcgctcaccgcgcttccgcccggcacccggctgcgggtggagacc
gagcagggggagacccgggccgccgccgaccggctgccgcccggcgtccaccggctgacc
gccaccgcgcccgacggccgcagcgccaccgcccacctcgtcgtcgccccggcccggctg
cccgcccccgccggacgctcccacggactcctcgtccagctgtactccctgctctcccgc
cgctcctggggcatgggcgacctcggcgacctcgcggagctggccggctgggccggacgg
accctcggcaccgggttcgtccaggtcaacccgctccacgcggccgtacccggggcgccc
accgacccttccccctaccggccctcctcgcgccgcttccccgacccggtgcatctgcgg
gtcgaggacatccccgagtacggccgggtcgaggaccgcgagcgggtgcgcgcgctgctg
gaacgggcccggctgctgcgggagtcggtgctggagaagggcgcgctgatcgaccgggat
ggggtgtgggatctgaagcgggaggcgctggagctggtgcgcgaggtcccgctcgggccc
gggcggcgggcggcctacgccgacttcctggccgccgaggggcaggcgctggaggaccac
gccacctggtgcgcgctggccgaggtgcacggctccgactggcgccgctggccggagccg
ctgcgtgatccgcggtccgcggaaaccgcccgtgcgcgcggcgagttgatggaccgggtc
gacttccactcgctgctcgcctggctgaccgacgcccagctcaccgccgcacagcgggtc
gcccgggaagcggggatggccgtcgggatcgtgcacgacctcgcggtcggcgtgcatccc
gacggggccgacgcctgggcgcagcaggagtacttcgcggccgggatgtcggtcggcgca
cccccggacgccttcaacgcgcgcggccaggactggggcctgccgccctggcgcccggac
cggctcgcggagtccggctacaccccgtaccggcgcctgctgaaggcgctgttccggtat
gccggggcgctgcggatcgaccacgtgatggggctgttccggctgtggtgggtgccgcag
gggcagccgccgacggacgggacgtacgtccgctacgacgccgaggcgatgctcgccatc
ctggtgctggaggcctccagggccggggcgctggtgatcggcgaggacctggggacggtg
gagccgggcgtgcgcgaggcgctgcgggcccggggcgtgctcggcacctcggtgctgtgg
ttcgagcgggactgggagggcgacgggcgtccgctgccgccggaacagtggcggtcggac
tgcctggccacggccaccacccacgacctgccctccacggcggcccggctgaccggcgag
catgtcgaactgcggcacagcctgggcctgttgacccgctcgctggcggaggaacgggcg
gaggccgcggccgacacgggggagtggctggccgtgctgtcccggctggggctgctgcac
ggcaccggcggggggcacggcacctcccaggaggaggccgagatccaggccgtccaccgc
ttcctgctgcgcaccccggcccgcatggtcggcgtctggctcccggacacggtcggcgac
cgccggccgcagaacctgcccggcacctgggaccagttcccgaactggcggctgcccatc
gccgacgcggagggcaagccggtgaccctggaggaactggcggcctcgcccagactgcac
gcgctgctggagctgatgcgcccggcctga

DBGET integrated database retrieval system