KEGG   Streptomyces davawensis: BN159_5706Help
Entry
BN159_5706        CDS       T02518                                 

Gene name
proB3
Definition
Glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sdv  Streptomyces davawensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN159_5706 (proB3)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN159_5706 (proB3)
Enzymes [BR:sdv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BN159_5706 (proB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6373419..6374525
Genome map
AA seq 368 aa AA seqDB search
MAEARRVVVKVGSSSLTTASGGLDADRVDALVDVLAKSRSGGEREIVLVSSGAIAAGLAP
LGLRRRPKDLARQQAAASVGQGLLVARYTASFARYGVRVGQVLLTSDDMSRRAHHRNASR
TLDKLLAMGALPVVNENDTVATDEIRFGDNDRLAALVAHLVRADLLVLLSDVDGVYDGDP
SRPGTSRIAEVRGPGDLAHVEIGSAGKAGVGTGGMVTKVEAARIAAAAGIPVVLTSAVHA
AEALSGGDTGTYFHATGRRSADRLLWLQHASTPQGSLTLDDGAVRAVVERRKSLLPAGIA
AVEGEFSAGDPVELRDGAGRAVARGLVSFDAKEIPQLIGRSTHELARELGPAYEREVVHR
DDLVLLEP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaggcccgcagggtcgtcgtcaaggtgggttcctcgtccctgacaaccgcctcc
ggagggctcgacgcggaccgtgtggacgccctcgtggacgtcctcgcgaagagccgaagc
ggcggggaacgtgagattgttctcgtttcctccggcgccatcgccgccggtctggccccg
ctcggactgcgtcgccgccccaaggacctggcccgccagcaggccgccgccagcgtcggc
cagggactgctcgtcgcccgctacaccgcctccttcgcccgctacggcgtccgcgtcggc
caggtgctgctcacctccgacgacatgagccgtcgcgcccaccaccgcaacgcctcgcgc
accctcgacaagctcctcgcgatgggcgccctgccggtcgtcaacgagaacgacaccgtc
gccacggacgagatccgcttcggcgacaacgaccgcctcgccgccctcgtcgcccacctg
gtccgcgccgacctgctggtgctgctgtccgacgtggacggcgtgtacgacggcgacccc
agcaggcccggcacctcgcggatagcggaggtacggggacccggggacctggcgcacgtg
gagatcggcagcgcgggcaaggccggggtcggcaccggcggcatggtcaccaaggtcgag
gccgcccggatcgccgccgccgcgggcatcccggtggtgctcaccagcgccgtgcacgcc
gccgaggcgctctccggcggggacaccggcacctacttccacgccaccggcagacgctcc
gccgaccggctgctgtggctccagcacgcctccacaccgcagggctcgctgaccctggac
gacggcgcggtgcgggccgtcgtggagcgccgcaagtcgctgctcccggccgggatcgcc
gccgtggagggcgagttcagcgccggggacccggtggagctgcgggacggggccgggcgg
gcggtcgcgcgcggtctggtcagcttcgacgccaaggagatcccccagctcatcgggcgc
tccacgcacgagctggcccgggagctgggcccggcgtacgagcgcgaggtcgtccaccgc
gacgatctggtgcttctggagccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system