KEGG   Streptomyces davawensis: BN159_6302Help
Entry
BN159_6302        CDS       T02518                                 

Gene name
choA
Definition
Cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sdv  Streptomyces davawensis
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:sdv00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7080906..7082558
Genome map
AA seq 550 aa AA seqDB search
MLRSMNAQLMQRQLTRRQILGMVALQTAAASGLTRIGLQSATAQEPAAVDNAPAIVVGSG
YGSSVAALRLGQAGIRTIVIEMGRLWNSPGPDGKVFCSTAAPDHRSMWFRTRTEAPLATF
LWLDVVNKDISAYPGVLDRVHFANMSVYVGRGVGGGSLVNGGMAVTPLKSYFSEQFPTVD
ADEMYSTYFPRARSMLGVNTVDPAWFESTEWYRFSRISRKHAANTGLKTTFVPNVYDFGH
MQREAAGTATKSALAGEVVYGNNHGKRTLDKTYLAAALGTGNVTIHTLERVTAISRATDG
TYQLTAQRIDDTGTAVETKQYACTYLFLGGGSLGTTELLLRARETGALPALDASVGTGWG
TNGNVMLGRANHLWDTVGANQSTMPVLGIDDWANTANPVFAEIAPLPTGLEHWVSLYLAI
TKNPERASFSYSGGSGGSLALGWTAAQSAVSAAMAKKLFDRINRANATIYRYDLFGSPSR
AFADDFTYHPLGGCVLGRATDNYGRVKGYSKLYVTDGSLVPGSIGVNPFVTITALAERTM
ARVLVEDTAP
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcagcatgaacgcacaactgatgcagcgtcagctgacgagacgtcaaatcttg
ggcatggtggcactccagaccgccgccgcgtccggtctcacccgcatcggtctccaatcg
gcgacggcacaagaacccgccgccgtggacaacgccccggcgatcgtggtcggttccggt
tacggatcttccgtggccgcgctccgcctcggtcaggcgggcattcgcaccatcgtcatc
gaaatgggccgcctctggaacagccccggccccgacggcaaggtcttctgctccaccgcg
gcccccgaccaccgctccatgtggttccgcacccgcaccgaagcccccctcgccaccttc
ctgtggctggacgtcgtcaacaaggacatcagcgcctacccgggcgtcctcgaccgcgtc
cacttcgccaacatgtcggtctacgtcggccgcggcgtcggcggcggctccctggtcaac
ggcggaatggcggtcaccccgctcaagtcgtacttctccgagcagttccccaccgtcgac
gcggacgagatgtactccacgtacttcccccgcgcccgctccatgctcggcgtcaacacc
gtggaccccgcctggttcgagtccacggagtggtaccgcttcagccggatctcccgcaag
cacgccgccaacaccgggctgaagaccaccttcgtgccgaacgtctacgacttcggccac
atgcagcgcgaggcggccggcacggccacgaagtccgcgctcgccggagaggtcgtctac
ggcaacaaccacggcaagcgcaccctggacaagacctacctcgccgccgccctgggcacc
ggcaacgtcaccatccacaccctggagcgggtcaccgccatcagcagggccacagacggg
acgtaccagctgaccgcccagcgcatcgacgacaccggcacggccgtcgagaccaagcag
tacgcgtgcacgtacctcttcctcggcggcggcagcctcggtaccaccgaactcctgctg
cgcgcccgggagacgggcgccctgcccgccctcgacgcgagcgtgggcaccggctggggc
accaacggcaatgtgatgctcgggcgggccaaccacctgtgggacacggtcggggcgaac
cagtcgaccatgccggtgctgggcatcgacgactgggccaacaccgccaaccccgtcttc
gcggagatcgcgccgctgccgacgggactcgaacactgggtcagcctctatctggcgatc
accaagaacccggagcgggcgtccttctcgtactcgggaggctcgggcggttcgctggcg
ctcggctggaccgcggcgcagagcgcggtctcggcggccatggccaagaaactgttcgac
cggatcaaccgggccaacgccacgatctaccggtacgacctgttcggctcgcccagccgg
gccttcgccgacgacttcacgtaccacccgctgggcggctgcgtgctggggcgggcgacc
gacaactacggccgggtgaaggggtattcgaagctgtacgtcaccgacggctcgctcgtg
cccgggtcgatcggcgtgaacccgttcgtgacgatcaccgcgctcgccgaacgcacgatg
gcgcgggtcctcgtggaggacaccgcgccatag

DBGET integrated database retrieval system