KEGG   Streptomyces davawensis: BN159_6313Help
Entry
BN159_6313        CDS       T02518                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sdv  Streptomyces davawensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7091912..7092691)
Genome map
AA seq 259 aa AA seqDB search
MPVLPGAEPYRHEGGEISVLLCHGFTGSPQSLRPWAEYLAARGLTVSLPLLPGHGTRWED
LQLTGWQDWYAEVDRELRALRERSTHLFVAGLSMGGALALRLAAKHGDAVDGVVVVNPAN
KVHGLAAHALPVARHLVRTTKGIASDIAKEGSDEVGYDRVPLHAAHSLRNFFRRVDGELP
QVTQPLLLLHSTQDHVVPPADSARVLSRVSSTDVTEIVLEQSYHVATLDHDAERIFAESH
AFMSRLAPSLGKEGTAVGG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtccttcctggagccgagccgtaccgccatgagggcggggagatctccgtactc
ctctgccacggcttcaccggttccccgcagtcgctgcgcccctgggcggagtatctcgcc
gcacgcggtctgaccgtctcgctgccgctgctgcccgggcacggcacccgctgggaggat
ctccagctcaccggctggcaggactggtacgcggaggtggaccgcgagctgcgcgccctg
cgggagcgctccacccacctcttcgtggccggtctgtccatgggcggtgccctggcgctc
cggctggcggcgaagcacggcgacgcggtggacggcgtggtggtcgtcaaccccgcgaac
aaggtgcacggcctggccgcgcacgcccttccggtggccaggcacctcgtgcggacgacg
aagggcatcgccagcgacatcgccaaggagggcagcgacgaggtcggctacgaccgggtg
ccgctgcacgccgcgcactccctgcggaacttcttccgccgggtcgacggcgagctgccg
caggtcacgcagccgctgctgcttctgcacagcactcaggaccatgtggtgccgcccgcc
gactcggcccgggtgctcagccgggtgtcgtcgacggacgtgacggagatcgtgctggaa
cagagctaccacgtggcgacgttggaccatgatgcggagcggatcttcgcggagagccac
gccttcatgagccggctcgcacccagtctcggcaaggaagggacggccgtaggtggctga

DBGET integrated database retrieval system