KEGG   Streptomyces davawensis: BN159_6624Help
Entry
BN159_6624        CDS       T02518                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sdv  Streptomyces davawensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN159_6624
   00500 Starch and sucrose metabolism
    BN159_6624
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     BN159_6624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7430330..7431352
Genome map
AA seq 340 aa AA seqDB search
MRRRTLLAGLTAGLVATGAGPVLASGRHVLHVRPGDYVQAAVDAVTGRPGCTIVIHPGIY
REVVKVPTEAVELTLRGATRDPRDVVIVYDNANGTQKPDGSGTYGTAGSATFTSAAPGLT
VRDLTLANDWLRADHPEITGTQAVAAYVTADRSSFDNVRLLAHQDTLFVDTTALDVFDRQ
YFHRCYIEGDVDFVFGRATAVFEHCHFHTVQRDVNFTPKGMVFAPSTARANPHGILALRS
RITSAAEDAAYKLARPWVPSYETTAWSSLVVRDTWIGPGVDPVAPYTNMREAYPWQTMRF
REFANSGPGAVISVPENRPQLAAAEAEAHTKRAYLGDWRP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtcgcaccctgctggcgggcctgaccgcgggtctcgtggcgaccggcgccgga
ccggttctcgccagtggccgccacgtcctgcacgtccgcccgggtgactacgtccaggcg
gccgtggacgcggtcaccggccgacccggctgcacgatcgtcatccacccggggatttat
cgagaagtcgtcaaagttcccaccgaagccgtcgagttgaccctgcgcggcgcaacccgc
gacccgcgcgacgtcgtcatcgtgtacgacaacgccaacggcacccagaagccggacggt
tcgggcacctacggcaccgcgggttcggcgaccttcacctcggccgcccccggactcacc
gtccgcgacctcaccctcgccaacgactggctgcgcgccgaccaccccgagatcaccggc
acccaggcggtcgcggcgtacgtgaccgcggaccggtcgagcttcgacaacgtccgcctc
ctggcccatcaggacaccctcttcgtcgacacgaccgccctggacgtcttcgatcggcag
tacttccaccgctgctacatcgagggcgacgtcgacttcgtcttcggccgggccaccgcc
gtcttcgagcactgtcacttccacaccgtgcagcgggacgtgaacttcacccccaaaggg
atggtcttcgccccctccacggcccgcgccaacccccacggcatcctcgcgctccgctcc
cgcatcacctccgccgccgaagacgcggcgtacaaactggcacggccctgggtgccgtcg
tacgagacgaccgcctggtcctcgctggtggtgcgggacacctggatcggtcccggtgtc
gatcccgtcgcgccgtacaccaacatgcgggaggcctacccctggcagaccatgcgcttc
agggagttcgccaactccggcccgggggccgtgatttccgtccccgagaaccgtccgcaa
ctcgccgccgcagaagccgaggcacacaccaagcgtgcctacctgggcgactggcggccg
taa

DBGET integrated database retrieval system