KEGG   Streptomyces davawensis: BN159_6679Help
Entry
BN159_6679        CDS       T02518                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sdv  Streptomyces davawensis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sdv00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7494547..7495278
Genome map
AA seq 243 aa AA seqDB search
MAEQRGKRRGAGEAGESAREVREPWPDGVRPEEARAWEDLVATARRTVSEGLVVGTSGNV
SVRVGDTVLVTPSGVPYDRLTPEDITGVDLSGRQVLGTLRPTSELPMHLAVYGATDARAV
VHTHAVHATAVSTLVQEVPAIHYITADLGGPARVAPYATYGTEELAENMLRALTDRTACL
LQNHGTMTYGTTLSQAYDRTAQLEWMCRVWLTASSVPGLTPSLLSGEQLAEVQQKLRGYG
QPT
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagcgagggaagcggcggggcgcgggggaagcgggggagagcgcacgggaa
gtgcgggagccgtggccggatggtgtacgtccggaggaggcgcgggcctgggaggacctg
gtcgccaccgcccgccggacggtctccgaggggctggtggtggggacctctggcaatgtc
tcggtgcgcgtcggggacacggtcctggtcacaccgtcgggagtgccgtacgaccggctc
acgcccgaggacatcacgggcgtcgacctctccggccgccaggtgctcggaacgctccgg
ccgaccagtgagctgccgatgcatctcgccgtctacggcgccaccgacgcccgcgccgtc
gtccacacccacgcggtgcatgccacggcggtctcgacgctggtccaggaggtcccggcg
atccactacatcaccgccgacctcggcggccccgcccgggttgccccgtatgcgacatac
ggcaccgaggagttggccgagaacatgctccgagccctgaccgaccgcaccgcctgccta
ctccagaaccacggcacgatgacctacggcacgaccctgtcccaggcctacgaccgcacg
gcgcagctggagtggatgtgccgagtgtggctgacggcatcttcggtgccgggcttgacg
ccgtcactgctgtcgggcgagcagctggccgaggtgcagcaaaagctccggggttacggt
cagcccacctag

DBGET integrated database retrieval system