KEGG   Streptomyces davawensis: BN159_7316Help
Entry
BN159_7316        CDS       T02518                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sdv  Streptomyces davawensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN159_7316
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BN159_7316
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN159_7316
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BN159_7316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8192712..8194283)
Genome map
AA seq 523 aa AA seqDB search
MSHRPFGRRSVLRGSLAASAALTLPTALGSAPAFALSGRPEAGWGVQTGDVTTDSGLVWV
RSDRPARMIVETSATESFRNPHRWHGPLLGADTDFTGTTRLRGLPSGEQIHYRVLLADPD
DPRRTGEPVTGTFRTASAKGRNGVRFLWSGDLAGQGWGINPDLGGFRIYDTMAGLDPDFF
LCSGDNIYADGPITGTVTLPDGRTWRNVTTEEKSKVAETLAEFRGNFRYNLLDENLRAFN
AQVPSIIQWDDHEVTNNWYPGEIFADARYTEKNVDVLAARARQAFSEYYPISTLRRPDGR
VHRVQHYGPLLDVFVLDMRTYRNANSPDNQTTDPVGILGRAQLEWLKRELSRSRAVWKVI
AADMPIGLVVPDGGDGKPHIEAVAQGDPGAPLGRELQIAELLRYIKHRRITGTVWLTADV
HYTSAQHYQPSRAAFTDFEPFWEFVSGPLNAGGFPANALDNTFGPERVFLKAPTVANVSP
AEGYQFFGEVDIDGESGELTVRLREQDGTVLFTQVLQPGRVGQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaccgtcccttcggccgccgcagtgttctgcgcggctcgctcgccgcctccgcg
gccctgaccctgcccaccgcgctcggctccgcgcccgcgttcgccctgtccgggcggccc
gaggcgggctggggcgtgcagaccggcgatgtgacgaccgactccggcctggtgtgggtc
cgctccgaccggcccgcccggatgatcgtcgagacgtcggccaccgagtccttccgcaac
ccccacagatggcacggcccgctgctcggcgcggacaccgacttcaccggtacgacccgg
ctgcgcggactgccgtcgggcgagcagatccactaccgcgtgctgctcgccgaccccgac
gacccgcgccgcaccggcgagccggtgaccggcaccttccgcaccgcgtccgccaagggc
cgcaacggcgtccgcttcctgtggtccggcgacctcgccgggcagggctggggcatcaac
cccgacctcggcggcttccgcatctacgacacgatggccggcctcgacccggacttcttc
ctgtgcagcggtgacaacatctacgccgacggcccgatcaccgggaccgtcaccctgccc
gacggccggacctggcgcaacgtcaccaccgaggagaagtcgaaggtcgccgagacgctc
gcggagttccgcggcaacttccgctacaacctgctcgacgagaacctccgcgccttcaac
gcccaggtcccctcgatcatccagtgggacgaccacgaggtcaccaacaactggtacccg
ggcgagatcttcgccgatgcccgctacaccgagaagaacgtcgacgtgctcgccgcccgc
gcccggcaggcgttctcggagtactacccgatctccacgctgcgccgccccgacggccgc
gtccaccgggtccagcactacggcccgctgctggacgtgttcgtcctcgacatgcgcacg
taccgcaacgccaactcgccggacaaccagaccaccgacccggtcggcatcctcggccgt
gcgcagttggagtggctcaagcgtgagctgtcccgctcgcgggcggtgtggaaggtgatc
gccgccgacatgccgatcggcctggtcgtaccggacggcggcgacggcaagccgcacatc
gaggcggtcgcgcagggcgacccgggcgcaccgctcggccgggagctccagatcgccgag
ctgctgcggtacatcaagcaccgcaggatcaccggcacggtgtggctgaccgccgatgtc
cactacacctcggcccagcactaccagccctcaagggccgcgttcaccgacttcgagccg
ttctgggagttcgtctcgggcccgctgaacgccggcggcttcccggccaacgccctcgac
aacaccttcggcccggagcgggtgttcctgaaagccccgaccgtcgccaacgtctccccc
gccgagggctaccagttcttcggcgaggtcgacatcgacggggagagcggggagctgacg
gtacggctgcgcgagcaggacggcaccgtgctgttcacgcaggtgctccagccggggcgg
gtcggccagtag

DBGET integrated database retrieval system