KEGG   Streptomyces davawensis: BN159_7418Help
Entry
BN159_7418        CDS       T02518                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
sdv  Streptomyces davawensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8300745..8302661)
Genome map
AA seq 638 aa AA seqDB search
MRTKHAARAVLALTATGAVLAPPAAAQAAEPLSVDLRADVDRDGQVDLSGDTDTAGEDTW
SVGRGAVFLPNIDDDSKRCPTAGPGGRPLSDAKLVGCNDATDQKVNGRADAADLARVRSV
PMRNLPSDAKGSVKVTKGAAQSRVFVKQDGAWKLVTSQTRLKRAELRAGVEFGVEGKDVI
RDSAKWDGRVSIRLRVTSSSGTASDTVTLRAAPLLTHHALQNTQQLLVTKVPGNEPWAKR
QRAFVKNLEKEAKAAGITKPPATFEKYGDIWAQDFVEPAYLNMTGPDGRQRTMRVMLRSA
QDRPAGRELYEKLRGPNVGVVQAKGRDMQGWETLNSFGNLETIPPYTHNGRSFPAGRNIM
GERKDGSGVRPSKEIRTLLKSQGLQDPLLLDTSWLHVGHVDEFVQFLPADTPRGWRIGIA
DPQAGLQLLRDAQRDGHGAKKMFSVPGFDGTLSPEETIDEALASRYLVSDNEMAAKKITA
NLEILKRETGVTDEEIVRVPALYTRGIVGDTEETTRMPLLRRLGGSGDPEAARKYGQQQL
AERAPSAAPPAPTVSTSAYVPGAVNGILLSRDRYLAPRQWGPVIGGKDIFTEAVTAAYTR
AGMKVSYVDDWYTYHLGMGEIHCGTNTLRDASGAWWKP
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacgaaacacgccgctcgggcggtgctggctcttaccgcgacgggagcggtgctg
gcaccgccggccgctgcccaggcggcggagccgctgagtgtggatctgagagcggatgtc
gatcgcgacgggcaggttgacctgagcggtgataccgacaccgccggtgaggacacctgg
tccgtcgggcgtggagcggtcttcctgccaaacatcgacgacgacagcaagcggtgcccg
accgccggtccgggcggacgcccgctctccgacgccaagttggtcggctgcaacgacgcc
accgaccagaaggtcaacgggcgtgccgacgccgccgacctggcccgggtccgctccgtg
ccgatgcggaacctgccgtccgacgccaagggcagcgtcaaggtcaccaagggggccgcg
cagagcagggtcttcgtcaagcaggacggtgcttggaaactggtgacctctcagacccgg
ctgaagcgggccgagttgcgtgccggcgtcgagttcggggtcgagggcaaggacgtgatc
cgggacagcgcgaagtgggacgggcgcgtctcgatccggttgagggtgacctcctcgtcc
ggcaccgcctcggacaccgtcaccctgcgcgccgccccgctgctcacccaccacgccctc
cagaacacgcagcagctgctggtcaccaaggtccccggcaacgagccctgggccaagcgg
cagcgcgcgttcgtcaagaacctggagaaggaggccaaggcggcggggatcaccaagccg
ccggcgaccttcgagaagtacggcgacatctgggcccaggacttcgtcgagcccgcctac
ctcaacatgaccggtccggacggacggcagcggacgatgcgcgtgatgctgcgctccgcc
caggaccgcccggcgggccgcgagctgtacgagaagctgcgcggcccgaacgtcggcgtc
gtccaggccaagggccgggacatgcagggctgggagaccctgaactccttcggcaacctg
gagaccatcccgccctacacgcacaacggccgctcgttcccggccgggcggaacatcatg
ggcgagcgcaaggacggcagcggtgtgcgcccctcgaaggagatacgcaccctgctgaag
tcccaggggcttcaggacccgctcctgctggacacctcgtggctgcacgtcgggcacgtc
gacgagttcgtgcagttcctgcccgccgataccccgcgcggctggcggatcggtatcgcc
gacccgcaggccggacttcagctcctgcgcgacgcgcagcgcgacggccacggcgcgaag
aagatgttctccgtccccggcttcgacggcactctctcccccgaggagaccatcgacgag
gccctggcctcccggtacttggtgtccgacaacgagatggcggccaagaagatcaccgcc
aacctggagatcctcaagcgggagaccggcgtcaccgacgaggagatcgtccgggtgccc
gccctctacacccgcggcatcgtcggcgacaccgaggagacgacgcgcatgccgctgctg
cgccgactcggcggcagcggcgacccggaggccgcccggaagtacggccagcagcagctc
gccgagcgcgccccctccgccgcgccaccggctcccaccgtctcgaccagcgcctacgtc
ccgggcgccgtcaacggcatcctgctctcccgcgaccgctacctcgccccgcgccagtgg
ggtcccgtcatcggcggcaaggacatcttcaccgaggccgtcacggccgcgtacacgcgc
gccggcatgaaggtctcctacgtcgatgactggtacacgtaccacctcggcatgggcgag
atccactgcggcaccaacaccctgcgcgacgcgtccggcgcctggtggaagccgtag

DBGET integrated database retrieval system