KEGG   Streptomyces davawensis: BN159_7451Help
Entry
BN159_7451        CDS       T02518                                 

Gene name
xylA
Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sdv  Streptomyces davawensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sdv00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sdv00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8349093..8350259
Genome map
AA seq 388 aa AA seqDB search
MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVETVQRLAELGAYGVTFHDDDLIP
FGSSDTEREAHIKRFRQALDATGMTVPMATTNLFAHPVFKDGAFTANDRDVRRYALRKTI
RNIDLAVELGAKTYVAWGGREGAESGAAKDVRVALDRMKEAFDLLGEYVTAQGYDLRFAI
EPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWADK
LFHIDLNGQSGIKYDQDLRFGAGDLRAAFWLVDLLESAGYAGPKHFDFKPPRTEDLDGVW
ASAAGCMRNYLILKERAAAFRADPEVQEALRASRLDELAQRTAADGLQALLADRTAFEDF
DADAAAARGMAFEQLDQLAMDHLLGARG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccagcccacccccgaggacaggttcaccttcggcctgtggaccgtcggctgg
cagggacgggaccccttcggcgacgccacccgtcgcgccctcgacccggtcgagacggtg
cagcgcctggccgagctcggcgcctacggcgtcacgttccacgacgacgacctgatcccc
ttcggatcctcggacaccgagcgcgaggcgcacatcaagcgcttccgccaggccctggac
gccaccggcatgaccgtgccgatggccaccaccaacctcttcgcgcaccccgtcttcaag
gacggcgcgttcaccgcgaacgaccgtgacgtgcgccggtacgccctgcgcaagaccatc
cgcaacatcgacctggcggtggagctgggcgcgaagacctacgtcgcctggggcggccgc
gagggcgccgagtccggcgccgccaaggacgtgcgcgtcgcgctggaccgcatgaaggag
gccttcgacctgctcggcgagtacgtcaccgcccagggctacgacctgcgcttcgccatc
gagcccaagccgaacgagccgcgcggcgacatcctgctgcccacggtcggccacgcgctg
gccttcatcgagcgcctggagcgccccgagctgtacggcgtcaaccccgaggtcggccac
gagcagatggccgggctgaacttcccgcacggcatcgcccaggccctgtgggcggacaag
ctcttccacatcgacctcaatggccagtccggcatcaagtacgaccaggacctgcgcttc
ggcgcgggcgacctgcgcgccgcgttctggctcgtcgacctgctggagagcgccgggtac
gccggcccgaagcacttcgacttcaagccgccgcggaccgaggacctggacggcgtgtgg
gcgtcggccgcgggctgcatgcgcaactacctgatcctcaaggagcgcgcggccgccttc
cgcgcggacccggaggtccaggaggcgctgcgggcttcgcgcctggacgagctggcgcag
cgcaccgccgccgacggccttcaggcactgctcgccgaccgcaccgccttcgaggacttc
gacgccgatgcggccgccgcgcgcgggatggccttcgagcagctcgaccagctggccatg
gatcacctgctgggagcgcgtggctga

DBGET integrated database retrieval system