KEGG   Streptomyces davawensis: BN159_8319Help
Entry
BN159_8319        CDS       T02518                                 

Gene name
glgB2
Definition
1,4-alpha-glucan-branching enzyme 2 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sdv  Streptomyces davawensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN159_8319 (glgB2)
Enzymes [BR:sdv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BN159_8319 (glgB2)
Exosome [BR:sdv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN159_8319 (glgB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9284658..9286865)
Genome map
AA seq 735 aa AA seqDB search
MALRDTSLPEPSGPARCGTAPPLDPTDRGRLLAGAHHDPHALLGAHVVPEGVVFRALRPF
ARAVSVVVDGERRALASEGEGLFSGVLPLAGIPSYTLLVSYEDGEQEVEDPYRFLPSLGD
LDLHLIREGRHEQLWKALGAEPMTHQGVTGTRFTVWAPNAQGVRVATDFTYWDGTAFPMR
SLGAAGVWELFLPGVAEGTRYKFEIHSRHGHRFLKADPMARHAEVPPDTASVVHSSQYEW
GDEEWMAHRGDVPVHVAPFSVYEVHLPSWRPGLTYRELAEVLPAYVNDLGFTHVELMPVA
HHPFSGSWGYQVTGFYAPMARLGTPDDFKFLVDALHRAGLGVIMDWVPAHFPKDDWALAR
FDGEPLYEPGDDRRAEHPDWGTYEFDFGRVEVRNFLVANAVYWCEEFHIDGLRVDAVASM
LYLDYSRDSGQWTPNVFGGREDLDAVAFLREMNATVYRRAPGVVTIAEESTAWDGVTRPT
DSGGLGFGLKWNMGWMHDSLGYMEHEPVHRKYHHHEMTFSMVYAYSENYVLPISHDEVVH
GKQALVSKMPGDWWQQRANHRAYLGFMWAHPGKQLLFMGQEFAQGAEWSEPDGPDWWLLD
PAYGAEPDHRGVRDLVRDLNSAYRAAPALWQRDTDPGGFRWVAGDAAEDNVFAFLRYAAD
GTPLLAVSNFSPVVRHDYRIWVPEDGPVWEETLNTDAAKYGGGDVTNPGPLKPEDDGIRI
TLPPLATVWLTPYPC
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgtgacacctccctgcccgagccgtccggccccgcccggtgcgggacggct
ccgccgctggatcccaccgaccggggccggctgctggccggtgcccaccacgatccgcac
gcgctgctgggggcccatgtggtcccggagggggtcgtgttccgggcgctgcgcccgttc
gcgcgcgcggtgagcgtggtcgtcgacggtgagcgccgggccctggcctccgagggcgag
gggctcttctccggcgtgctgccgctggccgggatcccgtcgtacacgctcctcgtgtcg
tacgaggacggggagcaggaggtcgaggacccgtaccgctttctgccctccctcggcgac
ctggatctgcatctgatccgggaggggcggcacgagcagttgtggaaggcgctcggcgcc
gagcccatgacccatcagggcgtgaccgggacccggttcacggtgtgggcgccgaacgcc
cagggggtgcgggtcgccacggacttcacctactgggacggcaccgccttcccgatgcgc
tccctcggcgcggcgggcgtgtgggagctgttcctgcccggggtcgccgagggcacgcgg
tacaagttcgagatccactcccggcacgggcaccgcttcctcaaggccgacccgatggca
cggcatgcggaggtaccgccggacacggcctccgtcgtgcactcctcgcagtacgagtgg
ggcgacgaggagtggatggcgcatcgcggggacgtgccggtgcatgtggcgccgttctcg
gtgtacgaggtccatctgccgtcctggcggcccgggctgacctaccgtgagctggccgag
gtgctccccgcctatgtcaacgatctcggcttcacccatgtggagttgatgccggtcgcc
caccatccgttctccggctcctggggctaccaggtcaccgggttctacgcgcccatggcg
cgcctcggcacccccgacgacttcaagttcctggtcgacgcgctccatcgggccggcctc
ggcgtgatcatggactgggtgcccgcccacttccccaaggacgactgggcgctggcccgc
ttcgacggggagccgctctacgagcccggggacgaccggcgggccgagcacccggactgg
gggacgtacgagttcgacttcgggcgggtcgaggtgcgcaacttcctcgtcgccaacgcc
gtgtactggtgcgaggagttccacatcgacgggctgcgggtggacgcggtcgcctcgatg
ctctacctcgactactcccgtgactccggccagtggacgcccaatgtgttcggcggccgg
gaggacctggacgccgtggcgttcctgcgggagatgaacgccaccgtgtaccggcgggca
ccgggtgtggtgacgatcgcggaggagtccaccgcctgggacggagtcacccggcccacc
gacagcggcggactcggcttcggcctgaagtggaacatgggctggatgcacgactccctc
ggctacatggagcacgagccggtccaccgcaagtaccaccaccacgagatgaccttctcg
atggtgtacgcctacagcgagaactacgtcctgccgatctcgcacgacgaagtcgtccac
ggcaagcaggcgctggtgtcgaagatgcccggagactggtggcagcaacgcgccaatcac
cgcgcctatctgggcttcatgtgggcccaccccggcaaacaactgctcttcatgggacag
gagttcgcccaaggtgccgagtggtcggagcccgacggccccgactggtggctgctggac
ccggcgtacggcgccgagcccgatcaccggggcgtgcgcgatctggtgcgtgatctcaac
tcggcctaccgggccgccccggcgctgtggcagcgggacaccgacccgggcggcttccgc
tgggtcgccggggacgcggcggaggacaacgtcttcgccttcctcaggtacgccgccgac
ggcacccccctgctcgcggtgtcgaacttctcccccgtcgtgcggcacgactaccggatc
tgggtgcccgaggacggtccggtgtgggaggagacgctcaacaccgacgcggcgaagtac
ggcggcggcgacgtcaccaaccccggcccgctgaagccggaggacgacgggatccggatc
acgctgccgccgttggcgacggtgtggctgacgccgtacccctgctga

DBGET integrated database retrieval system