KEGG   Streptomyces davawensis: BN159_8336Help
Entry
BN159_8336        CDS       T02518                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sdv  Streptomyces davawensis
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BN159_8336
Enzymes [BR:sdv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BN159_8336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9304511..9305467)
Genome map
AA seq 318 aa AA seqDB search
MLATPGTLPPAAQDARWAYETKQDGQRVVAYLDGDGGLVLRARSGEEVTAAYPELSPLSG
MLGATPAVLDGEVLALDEQGRADFQLLQSRMGLAHAPQRAARRAAEVPVHYALFDVMHLG
GRSLFRLPYLRRREQLEGLGLEGPHWSTPAALVGHGEQALRATREHGLEGLVCKRLDSVY
EPGVRSRNWIKIRNMRSADVVVGGWLPGKGRITGLPGAVLVGQRAGGRLRYVGGVGTGWS
AREREQLGVLLLAAETDVCPFDPVPAVPGARWVVPRLVGEVRFSTRTRAGLLRQPSWLRL
RPDLTPEESAADLPDDVD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccacgcccggcaccctgccgcccgccgcgcaggacgcgcgctgggcctacgag
accaagcaggacggccagcgggtggtggcctacctcgacggggacggcggtctggtcctg
cgggcccgttccggggaggaggtcaccgccgcctaccccgagttgagccccctctccggc
atgctcggcgcgacgcccgcggtgctggacggggaggtgctcgccctcgacgaacagggc
cgcgcggacttccagttgctccagtcccggatggggctggcccacgcgccgcagcgggcg
gcacgccgggccgccgaggtgccggtgcactacgcgctgttcgacgtcatgcacctcggt
gggcggtcactgttccgactcccctacctgcggcggcgggagcaactggaagggctgggg
ttggagggcccgcactggtccacacccgcggcgctggtcggccacggtgagcaggccctg
cgggcgacccgtgagcacggtcttgaggggctggtgtgcaagcggctggactccgtgtac
gagccaggggtgcggtcgcggaactggatcaagatccgcaacatgcgcagcgcggacgtc
gtggtgggcggctggctgccggggaaggggcggatcacgggtctgcccggtgcggtgctg
gtgggccaacgggccggcgggcggctgcggtacgtcggcggggtgggcaccgggtggagc
gcgcgggagcgggagcagctcggcgtgctgctcctggccgccgagacggacgtatgcccc
ttcgatcccgtgcccgcggtgccgggtgcgcgctgggtcgtgccgcggctcgtcggggag
gtgcggttcagcacgcgtacccgggccgggctgctgcggcagccgtcgtggctgcggctg
cggccggacctgacgccggaggagtcggcggccgatctgccggacgacgtcgactga

DBGET integrated database retrieval system