KEGG   Shigella dysenteriae Sd197: SDY_0071Help
Entry
SDY_0071          CDS       T00306                                 

Gene name
folA
Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00670  One carbon pool by folate
sdy00790  Folate biosynthesis
sdy01100  Metabolic pathways
Module
sdy_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SDY_0071 (folA)
   00670 One carbon pool by folate
    SDY_0071 (folA)
Enzymes [BR:sdy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SDY_0071 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 3798951
NCBI-ProteinID: YP_401798
ShiBASE_China: SDY0071
UniProt: Q32K48
Position
68384..68863
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRYTWESIGRPLPGRKNI
ILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLAKAQKLYLTHIDAEVE
GDTHFPDYEPNDWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtagatcgcgttatcggcatggaaaacgccatg
ccgtggaacctgcctgccgatctcgcctggtttaaacgcaacaccttaaataaacccgtg
attatgggccgctatacctgggaatccatcggtcgtccgttgccaggacgcaaaaatatt
atcctcagcagtcaaccgggtacggacgatcgcgtaacgtgggtgaagtcggtggatgaa
gccatcgcggcgtgtggtgacgtaccagaaatcatggtgattggcggcggtcgcgtttat
gagcagttcctggcaaaagcgcaaaaactgtatctgacgcatatcgacgcagaagtggaa
ggcgacacccatttcccggattacgagccgaatgactgggaatcggtattcagcgaattc
cacgacgctgatgcgcagaactctcatagttattgctttgagattctggagcggcggtaa

DBGET integrated database retrieval system